KEGG   Microterricola viridarii: AWU67_13125Help
Entry
AWU67_13125       CDS       T04252                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mvd  Microterricola viridarii
Pathway
mvd00250  Alanine, aspartate and glutamate metabolism
mvd00280  Valine, leucine and isoleucine degradation
mvd00310  Lysine degradation
mvd00410  beta-Alanine metabolism
mvd00640  Propanoate metabolism
mvd00650  Butanoate metabolism
mvd01100  Metabolic pathways
mvd01120  Microbial metabolism in diverse environments
Module
mvd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mvd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AWU67_13125
   00650 Butanoate metabolism
    AWU67_13125
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AWU67_13125
   00280 Valine, leucine and isoleucine degradation
    AWU67_13125
   00310 Lysine degradation
    AWU67_13125
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AWU67_13125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mvd01007]
    AWU67_13125
Enzymes [BR:mvd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AWU67_13125
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AWU67_13125
    2.6.1.48  5-aminovalerate transaminase
     AWU67_13125
Amino acid related enzymes [BR:mvd01007]
 Aminotransferase (transaminase)
  Class III
   AWU67_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 CW_binding_2
Motif
Other DBs
NCBI-ProteinID: AMB59651
UniProt: A0A0X8E5Y5
LinkDB All DBs
Position
complement(2873974..2875350)
Genome map
AA seq 458 aa AA seqDB search
MTLIDSAATVGTTAVPVGGPSLPQQRTLVTAIPGPKSQELLARKAQAVSASVGSTIPVFT
VAAGGGVLVDVDGNSLIDLGSGIAVTGVGNSAPRVVAAVAAQLEQFTHTCFTVAPYDSYV
EVAEALNRLTPGDHAKRSALFNSGAEAVENAVKIARHYTGKQAVVVFDHAYHGRTNLTMA
LTAKNQPYKNGFGPFAPEVYRVPTSYPLRDGGLSGAEAAKLSITQIEKQIGAGNLAAVMI
EPIQGEGGFIVPAEGFLPAIVDWCRANDVVFIADEVQTGFARTGTMFASEQFGIVPDLVV
TAKGIAGGLPLSAVTGRAEIMDAPQIGGLGGTYGGNPLACAAALATIETYEEDGLVERAA
EIGAIVREVFGAAQATDARIAEVRGLGAMMAIELVDAATGEPDASLTGRVAAATHAAGVI
VLTCGTYGNVIRFLPPLAISDALLREGLQVVLDSLAAN
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacactcatcgattcagcggctaccgtcggcaccaccgcagtacccgttggcgggccc
tcgctgccacagcagcgcacgctcgtgaccgctattcctggcccgaagtcgcaggagctc
ctcgcccgcaaggcgcaggccgtctcggcttcggtcggctcgaccatccccgtgttcacc
gttgccgccggcggcggcgtgctcgttgacgtcgacggcaactcgctgatcgacctcggc
agtggcatcgccgtcaccggcgtgggcaacagcgctcctcgggtcgtggccgccgtggcc
gcgcagctcgagcagttcacccacacctgcttcaccgtcgcgccctacgactcctacgtc
gaggtcgccgaggccctcaaccggctcacccccggcgaccacgccaagcgcagcgccctg
ttcaactccggcgccgaggccgtcgagaacgccgtcaagatcgcccgccactacaccggc
aagcaggccgtcgtcgtcttcgaccacgcctaccacggccgcaccaacctcaccatggcg
ctgaccgccaagaaccagccgtacaagaacggcttcggcccgttcgcccccgaggtctac
cgcgtgcccacgagctacccgctgcgcgacggcggcctgagcggtgcagaggccgccaag
ctctccatcacccagatcgagaagcagatcggcgccggcaacctcgccgccgtcatgatc
gagccgatccagggtgagggcggcttcatcgtccccgccgagggcttcctgcccgccatc
gtggactggtgccgcgccaacgacgtcgtcttcatcgccgacgaggtgcagaccggcttc
gcccgcaccggcaccatgttcgccagcgagcagttcggcatcgtgcccgacctcgtcgtc
accgccaagggcatcgccggcggcctgccgctgtcggccgtcaccgggcgcgccgagatc
atggacgccccgcagatcggcggcctcggcggcacctacggcggaaacccgctggcctgc
gccgcggcgttggccaccatcgagacgtacgaagaggacggcctcgtcgagcgcgccgcc
gagatcggcgcgatcgtgcgcgaggtcttcggcgccgcacaggccaccgacgcccgcatc
gccgaggtccgcggcctcggcgccatgatggcgatcgagctggtggatgccgcaacgggc
gagcccgatgcctccctcaccggccgggtcgccgcagccacccacgccgccggcgtgatc
gtgctgacctgcggcacctacggcaacgtcatccgcttcctgccgccgctggccatcagc
gacgcgctgctgcgcgagggcctgcaggtcgtgctcgactcgctggccgccaactag

DBGET integrated database retrieval system