KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_20580Help
Entry
X875_20580        CDS       T03029                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase dacA
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Pathway
mve00550  Peptidoglycan biosynthesis
mve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X875_20580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mve01002]
    X875_20580
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mve01011]
    X875_20580
Enzymes [BR:mve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     X875_20580
Peptidases and inhibitors [BR:mve01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   X875_20580
Peptidoglycan biosynthesis and degradation proteins [BR:mve01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   X875_20580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Tab2_like
Motif
Other DBs
NCBI-ProteinID: AHG80670
LinkDB All DBs
Position
complement(2174959..2176137)
Genome map
AA seq 392 aa AA seqDB search
MKKTLVKTVSVIGLAVSSIAYADLNTNFNLQAPQINAQTYILMDYNSGEVLVSLNPDQRQ
YPASLTKMMTSYVVGEALKEGKISNSDMVTVTENSWAQKFPGSSLMFLDLNTKVSVADLM
KGLIIVSGNDASVALAEHVSGSEAAFINEMNKYVQQFGLKNTHFTTVHGLDHPEQYSSAR
DMAIIGAHIIRDHPEEYKIHAEKEFQYNIKKPQPNRNGLLWDKTIQVDGLKTGHTDKAGY
NLVASAVNPNTRLISVVMGVPTYKGREVESKKLLQWGFANFETIKSLPAAQSVAEQAVYY
GEVNKVQLGSVQDSFVTIPKGRAADLKARYELEKKNLEAPLVKGQVVGKMIYQLDGKDVA
STNLQALQDVPEAGIFGKAWDWIALTVKSLFD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattagtgaaaaccgtcagtgttatcggccttgcggtatcaagcattgcc
tacgctgatttaaataccaactttaatctacaagccccacagattaatgcacaaacttat
attttgatggattataattccggagaggtattagtgagcttaaaccctgatcaacgccaa
tatcctgcatcattaacgaaaatgatgacgagctatgtagtgggcgaagcattaaaagaa
ggaaaaattagcaatagtgatatggttacagtaacggaaaactcttgggcacaaaagttt
ccgggctcttcattaatgttcttagatttaaacactaaagtttctgttgcagatttaatg
aaaggcttgattatcgtgtcaggtaatgatgcatctgtagctcttgcggaacacgtttcc
ggctctgaggcagccttcattaatgaaatgaataaatatgtgcagcaatttgggttaaaa
aacacacattttacgacggtgcacggtttagaccacccagagcaatattcttcagctcgt
gatatggcaattatcggagctcatattattcgtgaccaccctgaagaatataaaattcac
gcagaaaaagagtttcaatataacatcaaaaaaccacaaccaaaccgcaacggcttattg
tgggataaaaccattcaagttgatggtttgaaaacaggtcatactgacaaagccggttat
aacttagtggcttcagcggttaatccaaatactcgtttgatttcggttgtaatgggcgta
ccaacttacaaagggcgtgaagttgaaagtaagaaattactccaatggggttttgcgaac
tttgaaaccatcaaatcactcccagcagcacaatctgttgcagagcaagcggtctattat
ggtgaagtgaacaaagtacaattaggttcggtgcaagatagctttgtaaccattccaaaa
ggtagagcagcagacttaaaagctcgttatgagttagagaagaaaaacctcgaagcccct
ttagtaaaagggcaggtagtaggtaaaatgatttaccaattagatggtaaggatgttgcg
agcactaacttacaagcactacaagatgtaccggaagccggtattttcggtaaagcgtgg
gattggattgctttaacagtgaagagcctttttgactaa

DBGET integrated database retrieval system