KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_20610Help
Entry
X875_20610        CDS       T03029                                 

Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Pathway
mve00550  Peptidoglycan biosynthesis
mve01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    X875_20610
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    X875_20610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mve01011]
    X875_20610
Enzymes [BR:mve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     X875_20610
Peptidoglycan biosynthesis and degradation proteins [BR:mve01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   X875_20610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer SURF1 Sec15 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHG80673
LinkDB All DBs
Position
complement(2177967..2179916)
Genome map
AA seq 649 aa AA seqDB search
MFGKLAKFTSSNQREKVRDGQAESNLYARRALVAFVGVLALTGVLLANLYHLQVVNYNDY
QTRSNGNRIKLLPVPPARGLIYDRNGKVLAENLTYFGLFIVPEKTENIEQTLEELREVVG
LTDEDIENYNKEKKRTSRYTPIMLKGNLNETQMARFAVNQYRFPSLDVQAYYKRNYPYGE
LLTHIIGYVAKINESDKKKLQEEGKFGNYAGSHDMGKLGIEKFYEDQLHGITGFEEVEIN
NRGKVIRKLRDQPGVAGSSIRLSIDVELQQYVMSLIANYKGAVVVLDPRDSSILAMVSNP
SYDNNLFVGGISGKDYKALLDDPNRPLYSRVTQGTYPPASTIKAFMAVAGLEEGLITPTT
TISDPGYWILPGTTQRYRDWKRSGHGATNVNKAITESSDTFFYQLAYKMGIDKMSEWMKK
FGFGVKTGIDIFEESAGVMPTREWKQKRYKKPWVQGDTIPVGIGQGYWISTPLQLAKATA
VLINNGRVNTPHLMLEVQSSNSVTPYQDPLLYEDIKGVPDSYWNLAKLGMYNVNHASNGT
ARKVFASAFYHSAGKTGTAQVFNLNGKNYDKNAIKKELHDHAWYIGYAPYENPTMVVALI
LENAGGGSSAAAPVARQIMDYVLRKGVSEQPNLQNSEKNQPLVTEDNDE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaaattagcaaaattcacttcatcaaatcagcgagaaaaggtacgagacggg
caggcagaaagtaatctgtatgcccgccgtgccttagttgcgtttgtgggagtacttgct
ttaactggcgtgttgttagctaatctgtaccatttacaagtggttaattataatgactac
caaacacgttcaaatggtaaccgtattaaattattgccagtgccacctgcccgtgggcta
atttatgaccgtaatggaaaagtattagcggaaaacttgacctatttcgggctgtttatt
gtgccggaaaaaacggagaatattgagcagaccttagaagaactcagagaagtggttggg
ctgacagacgaagatatcgagaactacaataaagagaaaaaacgcacctctcgttatacg
ccgattatgctgaaaggcaatttgaatgaaacgcagatggcacgttttgcagtcaatcag
taccgctttccaagtttagatgtgcaggcatattacaagcgtaattatccttacggggag
ttattaacccatattatcggttatgtagcgaaaattaacgaaagcgataagaaaaagctg
caagaagaagggaaattcggtaattatgctggttcgcacgatatgggaaaactgggtatc
gagaaattctacgaagatcaattacacggtataacaggttttgaggaagtagaaattaat
aaccgtggtaaggttatccgtaagctgcgtgatcaacccggggttgccggcagtagcatt
cgtttaagtattgatgtggaattgcagcaatatgtgatgtcgctgattgctaattataaa
ggtgcggttgtggtgcttgatcctcgtgatagtagcattttggcaatggtatctaaccca
agttatgataataatttatttgtaggcggaatttcaggtaaggattataaagcgttgctt
gatgatccaaatagaccgctttatagccgtgtaactcaaggtacttatccgccggcatcg
actattaaagcatttatggcagtagccggtttggaagaaggacttattacgccgacaacg
actatttctgatcccggttattggattttacccggcacaacgcaacgttatcgagactgg
aaacgcagtggacacggtgcaaccaatgtgaataaagcgattaccgagtcatccgatacc
ttcttctatcagttagcctacaaaatggggattgataaaatgtcggaatggatgaagaaa
tttggctttggggtaaaaacaggaatcgatatttttgaggagtcggcaggtgtaatgcca
acccgagaatggaaacaaaaacgctataaaaaaccatgggtacaaggtgataccattcct
gttggaatcggtcaaggttactggatttcaaccccactacagcttgcaaaagcaacagcg
gtattgattaataacgggcgagtgaatacaccgcatttaatgcttgaagtacaaagcagt
aattcagtcacgccgtatcaagatccgttactttatgaagatattaaaggcgtgccggat
tcttattggaatttagcaaaacttggaatgtataacgtaaaccatgcctcaaatggtaca
gctcgtaaagtatttgcgagtgcgttttatcattcagcgggtaaaacgggaacagcccag
gtgtttaacttgaacggtaaaaattacgataagaatgctattaaaaaagagctgcacgat
cacgcgtggtatattggttatgctccttatgaaaacccgacaatggttgttgcgttgatt
ctagaaaatgcgggcggaggcagtagtgctgcagcaccagtggctcgtcaaattatggat
tatgtattaagaaaaggcgttagtgagcaacctaatttgcaaaactctgagaaaaatcaa
ccgcttgtaacagaggacaatgatgaatag

DBGET integrated database retrieval system