KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_11530Help
Entry
X874_11530        CDS       T03028                                 

Definition
(GenBank) ABC transporter, CydDC cysteine exporter
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
mvg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    X874_11530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mvg02000]
    X874_11530
Transporters [BR:mvg02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    X874_11530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N SfLAP RsgA_GTPase AAA_18 AAA_21 DUF87 AAA_29 Sigma54_activat MMR_HSR1 AAA_16 AAA_23 DEAD G-alpha ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: AHG77789
LinkDB All DBs
Position
complement(1247176..1248840)
Genome map
AA seq 554 aa AA seqDB search
MKSLFPFFSLYQTHFGRLLLGIVLAILGLAASIGLLSLSGWFLAASFLAANAIIFNFFYP
AGGVRGLAIFRTASRYFEKLVTHDATFRVLANLRVTVFKKLIPLSPSGLNRFRNSELLNR
LVADVDTLDTLYLNLISPFVSAVMIITFMAIGLSFVSVPLMLIICGTLSALLLIIPTVFY
RLGLKLGKKAVQSRANYRSQFIEWVQLNAEFLLFGNLRQTAEKLQHTEREWLNAQGQESR
LSGLSSGLLMLSNGILTCVVIYLASTAINVPTAQYPEALIALVVFCVMASNEILAPIGIA
FLHLGQVITAAERINEITEQQPNVQFNGSAKWQNLSQNQPLVRFENVNFAYLNGEQQVLN
NLSFEVLKGQKVAILGKTGSGKSTIFQLLNRNYDPASGQIWLNNCKIEDFPEQTLRSKLV
TLSQRVHIFSQTLKDNLLMGNATATDEQMIDVVQKVGLGYLLETEGLKLWLGEGGRPLSG
GEQRRLGLARLLLSSAEFVLLDEPTEGLDRETEQQILNLILTHCSDKTLLMITHRQSALE
KFDVIYRMDNGRLL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctgttcccattcttttctctctaccaaacgcatttcgggcgtttgttatta
ggtattgtactggcaattttaggcttggctgccagcattggcttgttgagtttatccggc
tggttcttagcggcttcctttttagccgccaatgcgatcatttttaactttttctaccca
gcaggtggcgtaaggggcttggcgattttccgcaccgcttcacgctattttgaaaaattg
gtcacgcacgatgccaccttccgagtgttggcgaacttgcgtgtgacggtgttcaaaaaa
ctgattccgctcagcccaagcggtctaaatcgtttcagaaatagcgaattgttgaaccgc
ttagtggctgatgttgataccttagataccctttatcttaacctgatttctccttttgtc
agtgcggtgatgatcatcacttttatggcaatcgggttgtcgtttgtttctgtaccgtta
atgctgattatttgtggcacgctgtcggcgttgctgctgattattcctacggttttttat
cgactagggctgaagctcggcaaaaaagcggtgcaaagccgagccaattaccgcagtcaa
tttattgaatgggtgcaactgaatgcggaatttttactgttcggcaatttacgccaaacg
gctgagaaattacaacataccgagcgagagtggctgaatgcacaaggtcaggaaagccga
ctttccgggctttcaagcggtttattaatgctttcaaacggcattttaacttgtgttgtg
atctatttagcttctaccgcaattaatgtgccgactgctcaatatcctgaagccttaatt
gcattggtggttttctgtgtaatggcgtccaacgaaattttagcccctatcggcattgcg
tttttgcatttagggcaagtgattactgctgcagaacgtattaatgaaattaccgaacag
cagcccaacgtgcaatttaacggttcggcaaaatggcaaaatttgagccaaaatcaaccg
cttgtacgttttgaaaatgtgaattttgcgtatttgaatggtgagcagcaggtattaaat
aatctctcttttgaagtattaaaagggcaaaaggttgcgattttgggtaaaacagggagc
ggaaaatcaaccattttccaattattaaaccgcaattatgacccagcaagcggtcaaatt
tggttaaataattgcaaaattgaagattttccggaacaaacgttacgctcaaaattagtt
acacttagtcaacgagtgcatatttttagccaaacactcaaagataatttattaatgggc
aatgcaactgcgaccgatgaacagatgattgatgtcgttcaaaaagtgggtttaggttac
ttactcgaaacagaaggattaaaactttggctcggcgaaggcggcagaccactttctggt
ggtgagcaacgccgtttaggtttagcccgcttattgcttagctcggcagagtttgtttta
ttagacgaaccaaccgaaggtttagatcgtgaaaccgaacagcagatcttaaatttaatt
ttaacgcactgttccgataaaaccttattgatgattacccatcgtcaaagtgcgttagaa
aaatttgacgtgatttatcgaatggataatgggcgtttgctataa

DBGET integrated database retrieval system