KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_920Help
Entry
X874_920          CDS       T03028                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
mvg00564  Glycerophospholipid metabolism
mvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X874_920
Enzymes [BR:mvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     X874_920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like GIDA Pyr_redox_3 Thi4 Pyr_redox_2 YbjQ_1
Motif
Other DBs
NCBI-ProteinID: AHG76730
LinkDB All DBs
Position
complement(102918..104516)
Genome map
AA seq 532 aa AA seqDB search
MQRNQQLAQVQQTQKWDFIIIGGGASGLGIAIDTASRGYKTLLLESHDFAKGTSSRSTKL
VHGGVRYLANGDVALVREALRERGRLAKNAAHLFKNQSFIIPNYTLKDCLMYRVGLGMYD
MLSGNLSLGKTQNIDKAEAKRRLPTLNDLGLRAGTVYQDGQFDDARLAVNMAQTVVEQGG
TVLNYAKVTSLHKTPQGKIDGVTFYDELNQQEHTVFGTAVINATGVFMNDILSMDHGSPK
KFVVPSQGIHLVLDKSFLPSNDALMIPKTSDGRVLFAVPWHEVLVVGTTDTLIEHPSYEP
IPLEQEVNFILTTAGQYLTRKPTRDDVKAVFAGQRPLAAPEKEGQSTKEVSRSHKVLTDP
TSGLVTITGGKWTTYRQMAEDTVEEALKVHPQLGNKPCRTVDLSIHGNIPAELVNLQDHL
YVYGSDIPELRGLMTAYPEYAEKIHPRLDYTVAEVIWAVRNEMAQTVEDVLARRVRLLFT
DARAAIDSAAKVAAIMAKEMGKDEMWQQQQVAQFLDVAKHYLLVDYQPQLIA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaatcaacaactcgctcaagtgcaacaaacacaaaaatgggattttatcatt
attggtggtggtgctagtggtttagggattgcaatagatactgcctctcgtggttataaa
accttattactagaaagccacgacttcgctaaagggacatcaagccgtagtactaaatta
gtgcatggtggtgttcgctatttagcaaacggtgatgtggcattagtgagagaagcattg
cgtgaacgtggtcgcttagctaaaaatgcggctcacctctttaaaaaccaaagtttcatt
attccaaactacacccttaaagattgtttaatgtaccgcgttggtttaggaatgtacgat
atgctctcaggcaatctcagtttaggtaaaacccaaaatattgataaagctgaagccaaa
agacgcttaccaacgttaaacgatttaggcttacgtgccggtactgtttatcaagatgga
caatttgatgatgctcgtttagccgtaaatatggcacaaacagtagtagaacaaggcggt
acagtgctgaactacgctaaagtaacgtcattacacaaaacgccacaggggaaaattgat
ggtgtcacgttctacgatgagctaaatcagcaagaacatacggtattcggtacagcagta
attaatgcaaccggcgtatttatgaatgatattttaagcatggatcacggtagcccgaaa
aaattcgttgtgccaagtcaagggattcacttagtgctagataaatcattcttaccaagt
aatgatgctttgatgatccctaaaacctcagacggacgggttctatttgctgtgccttgg
cacgaagttttagtagtaggcacaacagatacgctaatcgaacatccatcttatgaacca
attccattagaacaagaggtaaactttattttaactactgcggggcagtatctgacaaga
aaaccaactcgtgatgatgtaaaagcagtatttgcaggacaacgcccacttgctgcacct
gaaaaagaaggtcaaagcacgaaagaggtttctcgtagccataaagtcttaaccgaccca
accagcggcttagttactatcacaggtggcaaatggacaacctatcgccaaatggcagaa
gatacggttgaagaggcattaaaagttcacccacaattaggtaataaaccttgccgaaca
gtagatttatctattcacggaaacattccagcagagctagtaaatctgcaagaccatctc
tatgtttacggttcagacattccagaattgcgtggattaatgactgcttaccctgaatat
gcagaaaaaatccacccaagattggattacaccgtagctgaagtaatttgggcagttcgt
aacgagatggcacaaacagtggaagatgtgttagctcgccgtgttcgcttactctttacc
gatgcgagagcagctattgacagtgctgccaaagtagctgctattatggcgaaagaaatg
ggtaaagatgaaatgtggcaacaacagcaagtagctcaattccttgatgttgctaaacat
tatttattggttgattaccaaccacaattaattgcttaa

DBGET integrated database retrieval system