KEGG   Mannheimia varigena USDA-ARS-USMARC-1296: X808_6170Help
Entry
X808_6170         CDS       T03027                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mvi  Mannheimia varigena USDA-ARS-USMARC-1296
Pathway
mvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvi01100  Metabolic pathways
mvi01110  Biosynthesis of secondary metabolites
mvi01130  Biosynthesis of antibiotics
mvi01230  Biosynthesis of amino acids
Module
mvi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    X808_6170
Enzymes [BR:mvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     X808_6170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AHG75140
UniProt: W0QBC7
LinkDB All DBs
Position
659259..660347
Genome map
AA seq 362 aa AA seqDB search
MLQVNVELKERRYPIIIGEGILAQAASYSPLKAGDKVMIVSNPTVAFHYLETVTCTLTKL
GCQVDSVLIPDGEEHKNLDSLNLIFTALLDKNHNRDSTLIALGGGVIGDVAGYAAASYQR
GIRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPVSVIVDTNTLSTLPKREVSA
GLAEVIKYGAIFDIAFFEWLESHIDDLVSLKQDELEYCIQRCCQLKADVVARDETEKGER
ALLNLGHTFGHAIEARMGYGVWLHGEAVSVGMLEAAALSHILGDLNVEDVARLEKLLARA
NLPTISPDGMEPEEYLPYMWRDKKVLNGQLRLILLKSLGQAYVSAKATEQQVLESIEHFT
QR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggttaatgtggaattaaaagaacgccgctacccaattattattggagaggga
atacttgctcaggcagcaagttattcgccgttaaaagcaggcgataaagtgatgattgtt
tccaacccaactgttgcttttcattatctcgaaactgttacttgcactttaactaaatta
ggctgccaagtagattcggtgctaattcctgatggcgaagaacataaaaacttggattca
ttaaacctgatttttacggcgttgttagataaaaatcataatcgcgatagcactttaatt
gctttaggcggtggtgtcattggcgatgtagcgggatatgctgccgcttcttatcaacgt
ggtattcgttttatccaaattccaactacgttattagcacaggtggactcttctgttggc
ggaaaaactgcagttaatcatccacttggcaaaaatatgattggagctttctatcagcct
gtttcggttattgtcgataccaacacgctgtctactttaccaaaaagagaagtgagtgcg
ggtttggcagaagtcatcaaatatggggcaatttttgatattgcgttttttgaatggcta
gagagccacattgatgacttagtaagtttaaaacaagatgagttagaatattgcattcag
cgttgttgccaattaaaagcggatgttgttgctcgtgatgaaactgaaaaaggtgagcgt
gcattgctcaatcttggacatactttcgggcatgctattgaagctcgtatgggctatggt
gtatggctacacggcgaagctgtttctgttggtatgcttgaggcggctgcattgtctcac
attctaggtgacttaaatgtggaagatgtggctcgcttagaaaaattactggcgagagca
aatctacctactatttcgccagatggtatggagccagaggaatatttaccttatatgtgg
cgagataaaaaagtattgaacggccagttgcgtttgattttattaaaatcattaggtcaa
gcctatgtttcagcaaaagcaacagagcaacaagttttggaatctattgagcatttcact
cagcgttaa

DBGET integrated database retrieval system