KEGG   Methanococcus vannielii: Mevan_1243Help
Entry
Mevan_1243        CDS       T00554                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00790  Folate biosynthesis
mvn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mevan_1243
Enzymes [BR:mvn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     Mevan_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2
Motif
Other DBs
NCBI-ProteinID: ABR55140
UniProt: A6URL8
LinkDB All DBs
Position
complement(1276305..1276991)
Genome map
AA seq 228 aa AA seqDB search
MNKLILLARKIENEILREKVISFIENPASTHSEIKESGISIKNSPASIKRHHKYEGGLIE
HTASVVTLSLKIAEALRETYGIIPDSDLLISGAILHDLMKPQNYQTNNEKFDHVSDSNLE
HLTLCVSELYKRDFPLNVIKVVASHHGEHGPVSPDSIEAWIIHYADNIDASLNDIAVKIC
QARAREFGIDDSAIYKKVTPLKAYEMRSKSGKDKLKEFLKEQLEITEE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttattttgcttgcaaggaaaattgaaaatgaaattttaagggaaaaagta
atatcatttattgaaaatcctgcgtcaacacattctgaaataaaagaaagcggaatcagt
attaaaaactctcctgcaagtatcaaaaggcatcataagtacgagggcgggttaatcgaa
catactgcatcagtagtaacgctttctttgaaaatagccgaagcacttcgagaaacttat
ggaattattccagatagtgatttattgatttcgggggcaatacttcatgacttaatgaaa
ccccaaaattatcaaacaaataacgaaaaatttgaccatgtttcagattctaatttagaa
catttgaccctttgtgtgtcagagctttataagcgagattttccacttaatgttataaaa
gttgttgcaagtcatcacggagaacacggcccagttagtccagattcaattgaagcatgg
attatacattacgctgacaatatagatgcatcacttaacgatattgcggttaaaatatgc
caagctagggcacgagagtttggaattgatgatagtgcaatctataaaaaagtaactccg
ttaaaagcttatgaaatgcgttcaaaatccggtaaagataaattaaaagaatttttgaaa
gaacagttagaaataacggaagaataa

DBGET integrated database retrieval system