KEGG   Methanococcus vannielii: Mevan_1364Help
Entry
Mevan_1364        CDS       T00554                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mvn  Methanococcus vannielii
Brite
Enzymes [BR:mvn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mevan_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ABR55261
UniProt: A6URY9
LinkDB All DBs
Position
complement(1391547..1392725)
Genome map
AA seq 392 aa AA seqDB search
MNGLFSKTNNKEFKEIVQKISKRLNLNPNDLEKGFERKIITKYEYNDKKYLCFKKKLRHI
ERGTIVFLNDNFDYFCGYPKIKRAMMLKASLDKYFDKKIAIEEKLDGYNIRIIKFEDEIL
AVTRGGKICPFTTKKVKKYLKTTFLDDYPNLMLCGEMIGLNNPYVNQYYIEAEKDYENLG
FYIFDIRERETNIPYSISKKEELFKKYEIPHVKPIIIDKKDISKLWEILNTLNENKKEGV
ILKDPEMLMEPLKYTTQHTQCNDLSIAFKYTYDIGIDFMFSRIVREGYQSFEMSESKEEE
LNRAEKLGKSIFLPMIQTIKDVSEGITSKECFELFFESEPDFLEFMNYLKKMHVPIIIES
KEIMGKIIKVRICRIYNATTDKIKSHLEGNLW
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacttttttcaaaaactaataataaagaatttaaagaaatagttcaaaaaatt
tcaaaaaggctgaatttaaatccaaatgaccttgaaaagggatttgaacgtaaaataatt
acaaaatacgaatacaatgacaaaaaatacctctgttttaaaaagaagttaaggcatatt
gaaaggggcactattgtttttttaaacgataattttgactatttttgcggttatcctaaa
ataaaaagagcaatgatgcttaaagcgtctttagacaaatattttgataaaaaaattgca
attgaagaaaaattagatggatataatataagaattataaaatttgaagatgaaatactt
gcagtaactcgtggtgggaaaatatgcccgtttacaactaaaaaagttaaaaaatacctt
aaaaccacttttttagatgattatcccaatttaatgctttgtggagaaatgataggacta
aataacccttatgtaaaccaatattacattgaagcagaaaaagattatgaaaatttagga
ttttatattttcgatattcgagaacgtgaaacaaatataccttattcaatatctaaaaaa
gaagagctatttaaaaaatatgaaattccacacgtaaaaccaataataatcgataaaaaa
gatatttctaaattatgggaaatattaaacacactaaatgaaaataaaaaagaaggcgta
attttaaaagaccctgaaatgctaatggaacctttaaaatataccactcaacacacgcaa
tgtaatgacctttcaatagcatttaaatatacttatgatattggaatcgatttcatgttt
agtagaattgttagggaaggataccaatcctttgaaatgtccgaaagtaaagaagaagaa
ttaaatagggcagaaaaacttggaaaatcgatttttcttccaatgattcaaacgataaag
gatgtttcagaaggaatcacttcaaaagaatgttttgaactattttttgaatccgagccg
gattttttagaatttatgaattatttaaaaaagatgcatgtaccaattattatagaatcc
aaagaaattatgggtaaaatcattaaagttcgtatttgtagaatttataatgccacaacc
gacaagataaaaagccaccttgaaggaaacctctggtag

DBGET integrated database retrieval system