KEGG   Methanococcus voltae: Mvol_0053Help
Entry
Mvol_0053         CDS       T01251                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mvo  Methanococcus voltae
Pathway
mvo00500  Starch and sucrose metabolism
mvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mvol_0053
Enzymes [BR:mvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mvol_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ADI35713
UniProt: D7DRF3
LinkDB All DBs
Position
53759..54979
Genome map
AA seq 406 aa AA seqDB search
MYLSFNFEVHQPHRLNKFINNDMDLWGRYMDINLNKELFKTVSKKSYYPASYLLLDLIDE
YDIKVSFSITGTFIEQALEYDNYLLDIFKDLVDTKNVELMTETYYHSLSCFISEEEFTDE
VKKHQYMTKDLFKYEPKVFRNTELIYNNRVAKIIENMGFDGIFTEGVDRVLEYGSPNYLY
KTLSGLKVLLRNYSLSDDIGFRFSSQDWSEYPLTAEKYANWINGCNGDCINLYMDYETIG
EHHTKESGIFEFLTALPEQLAMLEDIEYATPSDLIKNCNPRGIINVFEHNTISWADMERD
ASAWLGNKMQDLAFQNLESLKNYINFFEYSKESQEYLLYKNLQTSDNFYYMCNKSSSDKD
VHNYFSHFQSPYDAYGIYLNTIHDFKNYIILKSTNNEIIDDIWIKN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatcttttaattttgaagtacatcaaccacatagattaaataaatttataaac
aatgatatggacttatggggtagatatatggatataaacctcaacaaagagctttttaaa
accgtatctaaaaaatcatactacccggcaagttatttattgttagatttaatcgatgag
tacgatataaaggtttcttttagtattaccggcacttttatcgagcaagctttagaatat
gacaattatcttttagatatttttaaagatttggtcgatactaaaaatgttgaattaatg
accgaaacatattatcattctttaagttgttttatttccgaagaagaatttaccgatgaa
gttaaaaaacatcaatatatgacaaaagatttatttaaatacgagccgaaagtttttaga
aatactgaattaatctataataatcgagttgcaaagataatcgaaaatatgggctttgat
ggcatttttaccgagggtgtagaccgtgttttagagtatggctctccaaattatctttat
aaaacactttctgggttaaaagtacttcttagaaactatagtttaagtgatgacatagga
tttagattttcatcacaagattggtcagaataccccttaactgctgaaaaatatgcaaat
tggataaatggctgtaatggggattgtatcaatctttatatggattatgaaactataggg
gagcatcacactaaagaaagtggtattttcgagtttttgactgcacttcctgagcaatta
gctatgttggaagatatagagtatgctacaccgtcagacttaataaaaaactgtaatcct
cggggtattatcaatgtatttgagcataatactatatcttgggcagatatggaaagagat
gcaagtgcttggttgggaaacaaaatgcaggatttagcatttcaaaatttggaaagtttg
aaaaattatataaatttctttgaatattcaaaagaatcacaagaatatttgttgtataaa
aatttacaaacgagtgataatttttattatatgtgcaataaatcgtcaagtgataaggac
gttcataattatttcagccattttcaaagcccttatgacgcatatggaatttatttaaat
acaatacacgattttaagaattatataatcttaaaatcaacaaataatgaaattattgat
gatatatggataaaaaattaa

DBGET integrated database retrieval system