KEGG   Methanococcus voltae: Mvol_1222Help
Entry
Mvol_1222         CDS       T01251                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mvo  Methanococcus voltae
Pathway
mvo00790  Folate biosynthesis
mvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mvol_1222
Enzymes [BR:mvo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     Mvol_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HD_2 TraI_2
Motif
Other DBs
NCBI-ProteinID: ADI36879
UniProt: D7DUR9
LinkDB All DBs
Position
1373213..1374076
Genome map
AA seq 287 aa AA seqDB search
MIKHTCNMDNLTVDSLFKEAEKINDPVLKEKTIEFLKNPLPTHSEIELSNVSLEESPASV
KRHHKYPKGLLEHTMAVTKLSYNIAVALEEVYGLELDKDLIVAGALLHDIMKPQNYQIKE
EIKEYKVKINNNDKNCKDFKDNENSDEKTEKTEKTEYITETKVIRRFDHSSDFHLEHLTL
ATSELYKRDFPLKLIKVVSSHHGDYGSSRPDSIEAWIIHHADNMDANLNDIAIRIGNSRA
RDLNVDDNKLYEKITPLKIYELRSHIGKENLIEYLKNMMNSNEENKR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacatacctgtaatatggataatttaacagttgacagcctatttaaagaagca
gaaaaaataaatgaccccgtacttaaagaaaaaactattgaatttttaaaaaatcccctc
ccaacacacagtgaaatagaattgtctaacgtttcgttagaagagtcccctgcaagtgtt
aaaagacatcacaagtacccaaaaggacttttggagcatacaatggcagtaactaaactt
tcatataatattgcagtagccttggaagaagtttatggcttagaattagataaagattta
attgttgcaggagcactactccacgacataatgaaaccccaaaattaccaaataaaagaa
gaaataaaagaatataaagttaaaattaataataatgacaaaaattgtaaagattttaaa
gataatgaaaattcagatgaaaaaactgaaaaaactgaaaaaacagaatacataactgaa
actaaggtcattagacgatttgaccacagttcagattttcatttggaacacttgacttta
gcgacttcagagctttataaaagagattttccattaaaattaatcaaagttgtttcaagt
catcacggtgattatggttcttcacgccctgattcgatagaagcttggattatacatcac
gctgataatatggacgctaatttaaacgatatagcaattagaattggaaattcaagagca
agagacttgaatgttgatgataacaaattatatgaaaaaataactcctttaaaaatatat
gaattacgttcacatattggaaaagagaatttaattgaatatttaaaaaatatgatgaat
tcaaatgaagaaaataagagataa

DBGET integrated database retrieval system