KEGG   Mycolicibacterium vaccae: MYVA_0464Help
Entry
MYVA_0464         CDS       T04356                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00220  Arginine biosynthesis
mvq00250  Alanine, aspartate and glutamate metabolism
mvq00290  Valine, leucine and isoleucine biosynthesis
mvq01100  Metabolic pathways
mvq01110  Biosynthesis of secondary metabolites
mvq01130  Biosynthesis of antibiotics
mvq01210  2-Oxocarboxylic acid metabolism
mvq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYVA_0464
   00290 Valine, leucine and isoleucine biosynthesis
    MYVA_0464
   00220 Arginine biosynthesis
    MYVA_0464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mvq01007]
    MYVA_0464
Enzymes [BR:mvq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MYVA_0464
    2.6.1.66  valine---pyruvate transaminase
     MYVA_0464
Amino acid related enzymes [BR:mvq01007]
 Aminotransferase (transaminase)
  Class I
   MYVA_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANI37728
LinkDB All DBs
Position
complement(479729..480997)
Genome map
AA seq 422 aa AA seqDB search
MSTHQAPWQTGGGQHVRQREFTQSSKLQDVLYEIRGPVHEHAGRLEAEGHRILKLNIGNP
APFGFEAPDVIMRDIISALPNAQGYSDSKGIVSARRAVFTRYELVEGFPRFDIDDVFLGN
GVSELIQMTLQALLDNGDQVLIPAPDYPLWTACTSLAGGTPVHYLCDETQGWNPDVADIE
SKITDRTKAIVVINPNNPTGAVYSREVLTQIADLARKHQLLLLADEIYDKILYDDAEHVS
LASVAPDLLTLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGISLLANMRLCPNVPA
QHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWEKLNEIPGVSCVKPRGALYAFPRLDPEV
YDIADDEQLVLDLLLQEKILVVQGTGFNWPTPDHLRIVTLPWARDLAAAIERLGNFLVSY
RQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacccatcaggcgccgtggcagaccggcggtggccagcacgtgcgccagcgtgag
ttcacgcagtcgagcaagctgcaggacgttctgtacgagatccgcgggccggtccacgaa
cacgcgggccgcctggaggccgaaggccaccgcatcctgaagctcaacatcggcaacccc
gccccgttcgggttcgaggcccccgatgtgatcatgcgcgacatcatctccgcgctgccc
aacgcgcagggctactcagactccaagggcatcgtcagcgcccgccgcgcggtgttcacc
cgctacgaactcgtcgagggcttcccgcgcttcgacatcgacgacgtgttcctcggcaac
ggtgtctccgagctgatccagatgacactgcaggcgctgctggacaacggggaccaggtg
ttgatcccggcgccggactatccgctgtggaccgcgtgcacttcgctggccggcggcacc
ccggtgcactacctgtgcgacgagacgcagggctggaaccccgacgtcgccgacatcgaa
tcgaagatcaccgaccgcaccaaggcgatcgtggtgatcaacccgaacaacccgaccggc
gcggtgtacagccgcgaggtcctcacccagatcgccgacctggcgcgcaagcaccagctg
ctgctgctggccgacgagatctacgacaagatcctctacgacgacgccgagcacgtctcg
ctggcctcggtcgcgccggacctgctgacgttgacgttcaacggactgtccaaggcctac
cgggtggccgggtaccgctccggatggctggtgatcaccggccccaaggaacacgcgagc
agtttcatcgagggcatcagcctgctggccaacatgcgcctgtgcccgaatgtgcctgcc
caacatgcgattcaggtggcactcggcggccatcagagcatcgatgacctggttcttccc
ggcggcaggttgctcgagcagcgcgatgtcgcgtgggagaagctcaacgagatccccggg
gtgtcctgcgtcaagccgcggggtgcgctgtatgcgttcccgcgcctggaccccgaggtg
tacgacatcgccgacgacgagcagctggtgctcgacctgttgctgcaggagaagatcctg
gtggtccagggcaccggattcaattggcccacacccgatcacctgcggatcgtgacattg
ccgtgggcccgcgacctggccgcggccatcgagcggctcggcaacttcctggtcagctac
cggcagtaa

DBGET integrated database retrieval system