KEGG   Mycolicibacterium vaccae: MYVA_0931
Entry
MYVA_0931         CDS       T04356                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00290  Valine, leucine and isoleucine biosynthesis
mvq00650  Butanoate metabolism
mvq00660  C5-Branched dibasic acid metabolism
mvq00770  Pantothenate and CoA biosynthesis
mvq01100  Metabolic pathways
mvq01110  Biosynthesis of secondary metabolites
mvq01210  2-Oxocarboxylic acid metabolism
mvq01230  Biosynthesis of amino acids
Module
mvq_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mvq_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYVA_0931
   00660 C5-Branched dibasic acid metabolism
    MYVA_0931
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    MYVA_0931
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MYVA_0931
Enzymes [BR:mvq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     MYVA_0931
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N DXP_synthase_N Pyr_redox_3
Other DBs
NCBI-ProteinID: ANI38167
LinkDB
Position
955253..956974
AA seq 573 aa
MNSTTVAQLIAERLRSQGVRRVFGLCGGHIQPIWDALARNGIEIVDVRHEAAAVYMAHAG
AELTGELGVALVTAGPGLTNAVTAISNAFVGRSPVLVISGRAPRPQTGMAAMQDIDQASV
VRPITRLAEQVSERHHVIPRLDKVIAAAIGAATGATGPAYIDFPTDLLDEVVHEADIPAL
AMRRREPTVVGPDPVAVDSAAELIRDASRILVIGGRSVRAAAATVREFLSATGAVYLDSG
ESRGAIRDDVPGFVPAVRGRAMNEADLVITLGRRLDFQLGYGSPAVFAPDARFLRIGTCF
DELGENRRGDVEMHADTGAALAALLARGAAPSAPDRAWIEDLRTANAARARALATKLAAP
DPDEDGRMTPNFVIGAVNDLLTDRSVAIADGGDILSFARVGLKPVDYLDCGALGCLGVGV
PFAVAAALQRPDDPVIAVIGDGSFGFTALEVDTAVRHGAKAVFVVVNNEAWNIERHDQVD
RFDGNIVGVDLPGCRYDLLGRSLGAHGERVEDASELADALKRALDNAPAVVDVLVSRHAK
SADYLGGLAEVPPRQAVGPWNAAELRRYEVSAS
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgaattcgacgacagttgctcagctgatcgccgagcgcctgcgcagtcagggtgtgcgc
cgggtattcggcctctgcggtggccacattcagccgatatgggatgccctggcgcgcaac
ggcatcgagatcgtggacgtacgccacgaggcggcggcggtctacatggcccatgccggt
gcagagctcaccggcgagctgggcgtggccctcgtgacggcggggccgggtctcaccaac
gcggtcacggccatctcgaacgcgttcgtcgggcgcagcccggtgctggtcatctcaggg
cgggcgccgcggccacaaaccgggatggccgcgatgcaggacatcgaccaggcgagcgtg
gtcaggccgatcacgcgactcgccgaacaggtctccgaacgccaccatgtgatcccacgg
ctggacaaggtgatcgcggccgcgatcggtgcggcgacgggagcaaccggtccggcctac
atcgactttcccaccgacctgctcgacgaggtcgtgcacgaagccgatatcccggcgttg
gccatgcggcgacgcgagccgacggtggtggggcccgacccggtggctgtcgacagcgcc
gccgagctgatccgggacgcgtcgcggatcctcgtgatcggcggccggtcggtgcgtgcg
gcggccgccacggtgcgcgagtttctctcggcgaccggggcggtgtatctggactccggg
gagagccgcggcgccatccgcgacgacgttcccggcttcgtccccgctgtccggggtcgc
gcgatgaacgaggcagacctcgtcatcacgctcggccggcgactggatttccagctcggc
tacggctcgcccgcggtcttcgcgcccgatgcccgcttcctgcggatcggcacctgcttc
gacgagctcggtgagaaccgccggggcgatgtggaaatgcatgccgacaccggcgcggcg
ctggcagcgctgttggcacgtggtgcggcgccgagcgcgccggaccgcgcgtggatcgag
gacctccgcacggccaacgccgcccgcgcacgcgcgctcgcgaccaaactggctgcgccg
gacccggacgaggacggccggatgacaccgaacttcgtcatcggcgcggtcaacgatctg
ctgaccgaccgctcggtcgccatcgccgacggcggcgacatcctgtcgttcgcccgggtc
gggctcaagcctgtcgactacctcgactgcggtgcgctgggctgtctcggcgtcggggtg
ccgttcgcggtcgcggcagcgctgcaacggccggacgatcccgtcatcgccgtgatcggc
gacggcagtttcggtttcacggcgctggaggtggacaccgctgtccggcatggtgccaag
gcggtgttcgtggtcgtcaacaacgaggcgtggaacatcgagcggcacgaccaggtcgac
cgcttcgacggcaatatcgtcggggtcgatctgcccggctgccggtacgacctgctgggg
cgcagcctcggcgcgcacggcgagcgggtcgaggacgcgagcgaactggccgacgccctc
aaacgcgccctcgacaacgcaccggccgtggtcgacgtcctggtctcccggcacgccaag
tccgccgactatctcggcgggctcgcggaggtgccgccacggcaggcggtcggtccgtgg
aatgccgcggagctgcggcgctacgaggtgagcgcgtcatga

DBGET integrated database retrieval system