KEGG   Mycolicibacterium vaccae: MYVA_1381Help
Entry
MYVA_1381         CDS       T04356                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00564  Glycerophospholipid metabolism
mvq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYVA_1381
Enzymes [BR:mvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MYVA_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N HI0933_like AlaDh_PNT_C Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANI38595
LinkDB All DBs
Position
1415423..1417168
Genome map
AA seq 581 aa AA seqDB search
MSDPIPAPGNGQTFLSPRQRERAWDRLGSEQFDVIVIGGGIVGAGAALDAATRGLKVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPL
TNRWWERPYIAAGIFLYDQLGGAKSVPPQKHLTRAGALRLSPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRTSTQVVALLREGDRVTGVRVRDSEDGAVTEVRGHVVVNA
TGVWTDEIQALSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGEVNKVLATPVSHEDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPAPGLVAIAGGKYTTYRVMAQDAIDAAAEFIPTRVAPSITEKVPLLGAD
GYFAMINQTQSVGAYYGLHPYRVRHLLDRYGSLIGEVLSLADDRPELLEPITEAPVYLKV
EAAYAAVAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPLLGWSAEDVDREVAT
YLARVEAEVLSQTQPDDESADALRAAAPEARAEILEPVPLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacccgatccccgctccaggcaacggccagacgtttctgagcccccggcagcgg
gagcgcgcctgggaccggctcggcagcgagcagttcgacgtgatcgtcatcggcggcggc
atcgtcggggcaggggccgcgctggacgcggccacccgcggcctgaaggtcgcactggtc
gaagcacgcgacttcgcctccggcacgtccagccgcagcagcaagatgttccacggcggc
ctgcggtatctggagcagctggagttcgggctggtgcgcgaggccctgcacgaacgcgag
ctgtcgctgaccacactggccccgcatctggtcaagccgctgccgttcctgttcccgttg
accaaccgatggtgggagcggccctacatcgcggccgggatctttctctacgaccagctc
ggcggcgcgaaatcggttccgccgcagaagcatctgacgcgggcgggggcgcttcggctg
tctcccgggctcaagcgcagctcgctgatcggcggaatccggtactacgacaccgtcgtc
gacgacgcccggcacacgatgaccgtggcgcgcaccgccgcccactacggcgcggtggtg
cggacctcgacgcaggtggtggcgctgctgcgggagggggaccgggtcaccggtgtgcgg
gtacgcgactccgaggacggtgcggtcaccgaggtgcgcggccacgtggtggtcaacgcg
accggggtgtggaccgacgagatccaggcattgtccaagcagcgcggccggtttcgggtg
cgggcgtccaagggcgtgcacatcgtggtgccgcgcgaccgcatcgtgagcgaggtcgcg
atcatcctgcgcaccgagaagtcggtgctgttcgtcatcccgtggggtacgcactggatc
atcggcaccaccgacaccgactggaatctcgacctcgcgcacccggcggcgaccaaggcc
gacatcgactacatcctgggagaggtcaacaaggtgctggccactccggtgagccacgaa
gacatcgacggcgtgtacgccgggttgcgcccactgctggccggtgagagcgaggagacc
tcgaagctgtcccgcgagcacgcggtggcggtgccggcgcccggcctggtggccattgcc
ggcggcaagtacaccacctaccgggtgatggcccaggacgcgatcgacgcggccgcggag
ttcatcccgacccgggtggcgccgtcgatcaccgagaaggtgccgctgctcggggccgac
gggtacttcgcgatgatcaaccagacccaaagcgttggtgcgtattacggtctgcatccg
taccgggtccggcatctgctggaccggtacggttcgctgatcggcgaggtgctctcgttg
gctgacgaccggcccgaactgctggagccgatcaccgaggcgccggtgtacctgaaggtg
gaggcggcctacgccgcggttgcggagggcgcactgcacctggaggacatcctggcgcgc
cggatgcggatctccatcgagtacccgcaccgcggggtggactgtgcccgtgaggtcgcc
gaagtggttgcgcccctgctgggttggagcgccgaggacgtcgaccgcgaggtcgcgacg
tacctggcccgcgtcgaggccgaggtgttgtcgcagacccagcccgacgacgagtccgcc
gacgcgttgcgcgcggccgctccggaggcgcgtgcggagatcctcgagccggtgccgctc
aattga

DBGET integrated database retrieval system