KEGG   Mycolicibacterium vaccae: MYVA_1612Help
Entry
MYVA_1612         CDS       T04356                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00040  Pentose and glucuronate interconversions
mvq00051  Fructose and mannose metabolism
mvq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYVA_1612
   00051 Fructose and mannose metabolism
    MYVA_1612
Enzymes [BR:mvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     MYVA_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ANI38815
LinkDB All DBs
Position
1667558..1668610
Genome map
AA seq 350 aa AA seqDB search
MKGIEMTAAVEPVPATMRASVMTGVRSLQIVDRPVPTPGERQVLVEVAAVGVCGSDVHYY
LHGRIGDFVVDEPMVLGHELSGRIAAVGAGVDPERIGQRVAVEPQHPCRRCTQCKAGRYN
LCPHMEFYATPPVDGAFCRYVLIDDDMAHPVPDTISDEAAALLEPLSVAIATMRKARVAP
GTSILIAGAGPIGVICAQTARAFGAARIVVTDLVAERREKALQFGATETLDPTVVDVTAI
DPVDAFVDATGVPAAVVSGIKAVGPAGHVVLVGMGADEYALPVSHIANHEITVTGVFRYT
DTWPAAIHLVASGAVDLDGMVTGRYDLEHVGDALDSDSDPASLKSIVVPA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggatcgagatgaccgcagcggtcgaacccgtgccggccaccatgcgggccagc
gtcatgacgggtgtgcgcagcttgcagatcgtggaccgcccggtacccacgcccggtgaa
cgccaggttctcgtcgaggtcgccgcggtcggcgtgtgcggctccgacgtccattactac
ctacacggccgcatcggcgatttcgtcgtcgacgagcccatggtcctgggacacgaacta
tccggtcgcatcgccgctgtcggggcgggcgtggacccggagcggatcggtcagcgcgtc
gcggtcgagccgcagcacccgtgccggcgctgcacccagtgcaaggccgggcgctacaac
ctgtgcccgcacatggagttctatgcgactccgcccgtcgacggagcgttctgccggtac
gtgctgatcgacgacgacatggcccatccggtacctgacacgatctccgacgaggcggcc
gcgctgctcgaaccgctgtcggtcgcgatcgccacgatgcgcaaggcgcgggtcgcgccg
ggaacgtcgatcctcatcgcgggtgccggacccatcggcgtgatctgcgcgcagaccgcc
cgggccttcggcgcggcgcgcatcgtcgtcaccgatctggtcgccgagcgccgggagaag
gcgctgcagttcggcgcgaccgagacgctcgaccccacggtcgtggacgtcaccgcgatc
gacccggtcgatgccttcgtcgacgccaccggcgtgccggctgccgtcgtcagcggaatc
aaggcggtggggccggccggacacgtggtgctcgtcggaatgggcgccgacgaatacgcg
ctgccggtcagtcacatcgcgaaccatgagatcaccgtgaccggggtcttccgctacacc
gacacctggcccgccgcaattcatctcgtcgccagtggcgccgtcgatctggacggcatg
gtgaccggccgctacgacctcgagcacgtcggtgacgccctcgacagcgactccgatccg
gccagcctcaaatcgatcgtggtgcccgcgtga

DBGET integrated database retrieval system