KEGG   Mycolicibacterium vaccae: MYVA_2485Help
Entry
MYVA_2485         CDS       T04356                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mvq  Mycolicibacterium vaccae
Pathway
mvq00250  Alanine, aspartate and glutamate metabolism
mvq00280  Valine, leucine and isoleucine degradation
mvq00310  Lysine degradation
mvq00410  beta-Alanine metabolism
mvq00640  Propanoate metabolism
mvq00650  Butanoate metabolism
mvq01100  Metabolic pathways
mvq01120  Microbial metabolism in diverse environments
Module
mvq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYVA_2485
   00650 Butanoate metabolism
    MYVA_2485
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYVA_2485
   00280 Valine, leucine and isoleucine degradation
    MYVA_2485
   00310 Lysine degradation
    MYVA_2485
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYVA_2485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mvq01007]
    MYVA_2485
Enzymes [BR:mvq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MYVA_2485
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MYVA_2485
    2.6.1.48  5-aminovalerate transaminase
     MYVA_2485
Amino acid related enzymes [BR:mvq01007]
 Aminotransferase (transaminase)
  Class III
   MYVA_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANI39656
LinkDB All DBs
Position
complement(2557755..2559095)
Genome map
AA seq 446 aa AA seqDB search
MSALEQSRHLATAIPGPRSAELIARKGAAVARGVGNTMPVYAARAFGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVERATEQLRNFTHTCFMVTPYEGYVAVAEALNRLTPGDGDKRS
ALFNSGSEAVENAVKIARAYTGKQAVVAFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAARRAITVIDKQVGADNLAAVVIEPIQGEGGFIVP
AEGFLPTLLQWCRANGVVFIADEVQTGFARTGAMFACEHEGIVPDLIVTAKGIADGLPLS
AVTGPAAIMDAPHVSGLGGTYGGNPVACAAALATIETIEAEGLVQRAAQIETLMKDRLGR
LQAEDERIGDVRGRGAMIAVELVKPGTLDPDPELTRNLLAGAHQAGVIVLSCGTYGNVLR
FLPPLAISDELLLEGLDVLELILRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctggaacagagccgccacctcgccaccgccatccccggcccccgctccgcc
gagttgatcgcgcgcaagggcgcagcggtcgcccgcggcgtcggcaacacgatgccggtc
tacgcggcgcgggcgttcggcggcatcgtcgaagacgtcgacggcaaccggctgatcgac
ctcgggtcgggcatcgcggtcaccaccatcgggaactcctcccccagagtggtggagcgg
gcgaccgagcaactgcgcaacttcacccacacctgcttcatggtgaccccgtacgagggc
tacgtggccgtcgccgaagcgctcaaccggctgaccccgggcgacggcgacaagcgctcg
gcgctgttcaactccggctccgaggccgtcgagaacgccgtcaagatcgcccgggcttac
accggcaaacaggcggtggtggcgttcgaccacgcctaccacggccggacgaacctgacg
atggcgctgacggccaagtcgatgccctacaagcacggcttcggccccttcgccccggag
atctaccgcgcgccgctgtcctacccgttccgcgacgccgagttcggcaaggagctggcc
accgacggtgagctcgccgcccggcgcgccatcaccgtgatcgacaagcaggtcggcgcc
gacaacctggccgcggtggtcatcgagccgatccagggcgagggcggtttcatcgtgccc
gccgaaggcttcctgccgaccctgctccagtggtgccgggccaacggcgtggtgttcatc
gccgacgaggtgcagaccggcttcgcgcgcaccggcgcgatgttcgcgtgtgaacacgag
ggcatcgtcccggacctcatcgtcaccgcgaagggcatcgccgacggcctgcccctttcg
gcggtcaccggtcccgcagcgatcatggacgccccgcacgtcagcgggctgggcggcacc
tacggtggcaacccggtggcatgtgcggccgcgctggccaccatcgagaccatcgaggcc
gagggcctggtgcagcgcgcggcgcagatcgagacgctgatgaaggacaggctgggccgg
ctgcaggccgaggacgagcgcatcggcgacgtccgcggccgcggcgcgatgatcgccgtc
gaactggtgaaacccggcacgctggaccccgacccggagctgacccggaacctgctcgcg
ggcgcgcatcaggccggcgtgatcgtgctgtcctgcggcacctacggcaacgtgctgcga
ttcctgcccccgctggcgatcagcgacgagcttctgctcgaaggcctcgacgttctcgaa
ctcatcctgcgcgatctctga

DBGET integrated database retrieval system