KEGG   Mycolicibacterium vaccae: MYVA_3535Help
Entry
MYVA_3535         CDS       T04356                                 

Definition
(GenBank) 2-methyl 1,2 propanediol dehydrogenase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
mvq  Mycolicibacterium vaccae
Brite
KEGG Orthology (KO) [BR:mvq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MYVA_3535
Enzymes [BR:mvq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     MYVA_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 DAO GMC_oxred_N Pyr_redox_2 FAD_binding_3 Pyr_redox_3 NAD_binding_8 Lycopene_cycl HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ANI40665
LinkDB All DBs
Position
complement(3667497..3669179)
Genome map
AA seq 560 aa AA seqDB search
MDEKGEFIVNKSGADDTDVLVIGAGPGGAGVTLELVQAGYKVICLEQGPWVSSTEHPHYH
REWEIEKQRGWAYDPNVRGLPEDYPVTGFTTPYLMNNVGGSTMHYAGHWPRYKPVDFRKG
TEHGLEGTIDWPISYEELAPYYDKNDAIYGISGTVGDPSYPDRSGVDRDPPVLPGKLGRN
FANALGGLGWHWWPSDNAIITRPRENRDADVAAGNELSGSPTGSLSTPAHTHWPFAIALG
ADLRTFARVEQIHAKNGKATGATYIDTRTGDRHEITAKIVVVAASGIGTPRLLLMSAQKG
HPDGLANSNGLVGKYLMHHIFAFCDAWFDKPMEGYKGAFGAPLYSHEFYHTDTDRGFVNG
FGMQVARSFGAAFSAMGSHTGYVAPWGADHRNFFNDHFGNHLMVFMFGEDLPVETNCVTL
DTDAKDSSGLPAAHVNWEPHANDIALANFGIDRIFDAARALGAVETNDTGVLNPPPGWHL
MGTCRMGNNPQDSVTNKWNQTWDIPNLFVVDGSSLTTGGAVNPTSTIGALAVRAGEYISR
RFADIVDQKTTPSNADAPAI
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
ttggacgaaaaaggagagttcatagtgaacaaatctggagcagacgacaccgacgtcttg
gtgatcggcgcaggccccggcggcgcaggggtgacgctggaactggtgcaagccggctac
aaggtgatctgcctcgagcaggggccctgggtgtcttcgaccgaacatccgcactatcac
cgcgagtgggagatcgagaagcagcgcgggtgggcgtacgaccccaacgtccgtggcctg
cccgaggattacccggtcaccggtttcaccactccgtacctcatgaacaacgtcggcggc
agcaccatgcactatgccggccactggccccgctacaagccggtggacttccgcaagggc
actgagcacggactcgaaggcaccatcgactggccgatcagctacgaggagctggcgccg
tactacgacaagaacgacgccatctacggcatctcgggcacggtaggcgacccgtcttac
cccgaccgctccggcgtcgaccgcgacccgccggtgctgccgggcaaactcggccgcaac
ttcgccaatgccttgggcggcctgggctggcactggtggccgtcggacaatgcgatcatt
actcgcccacgggagaaccgtgacgccgacgttgctgcaggcaacgagctttcgggcagc
cccaccggatcgctgagcaccccggcgcacacccactggccgttcgccatcgcactcggc
gctgacctgcgcacgttcgccagagtagagcagatccacgccaaaaacggaaaggccacg
ggggcaacgtatatcgacacccgcaccggcgaccggcacgaaatcaccgcgaagatcgtg
gtggtcgctgccagcggcatcggaacgccgcgcctgctgctgatgagtgcgcagaaggga
cacccggacggcctggccaatagcaacggtctggtgggcaagtacctgatgcaccacatc
ttcgcgttctgcgacgcctggttcgacaaacccatggaaggctacaagggtgcgttcggc
gcgccgctgtactcgcacgagttctaccacaccgacaccgaccgaggattcgtgaacggg
ttcggcatgcaggtagcccgtagcttcggcgcggcgttctccgccatgggcagccacacc
gggtacgtggctccgtggggcgccgatcaccgcaatttcttcaacgatcacttcggcaat
catctgatggtgttcatgttcggggaggaccttccggtggagaccaactgcgtcaccctc
gataccgacgccaaagattccagcgggctgcctgccgcacatgtcaactgggagccgcac
gccaacgacatcgcgctggcgaacttcggtatcgaccggatcttcgacgcggcgcgggcg
ctcggcgcggttgagaccaacgacaccggtgtgctcaacccgcctccggggtggcatctt
atgggtacctgcaggatggggaacaacccgcaggattccgtgacgaacaaatggaaccag
acctgggatattcccaatttgttcgtcgtcgacggcagttcgctcaccaccggcggcgcc
gtgaacccgacctccaccataggggcgcttgcggttcgcgccggcgagtacatctcacgg
cgcttcgccgacatcgtggaccagaagaccacaccgagcaacgcagatgcccctgctatc
tga

DBGET integrated database retrieval system