KEGG   Mycolicibacterium vaccae: MYVA_4766
Entry
MYVA_4766         CDS       T04356                                 

Definition
(GenBank) hypothetical protein
Organism
mvq  Mycolicibacterium vaccae
SSDB
Motif
Pfam: BKACE
Other DBs
NCBI-ProteinID: ANI41836
LinkDB
Position
complement(4956249..4956986)
AA seq 245 aa
MVCMPPTPQTYVKACINGVRTPDQHPNLPVTPDELAAEAVAAHRAGAKAVHMHPKNADGV
DSLHAAEVDAAVAAVRQALPGLPLGVTTGFWALPDPGQRLRAVQSWTVLPDFASLNWHEP
GSPELADVLLGRGLGVEVGIFHAEAAQAWAASDIAAHCMRVMIELGADGDVSTADELLGI
IASAGSPAPVLLHGLDESCWPLLEHAGARGVQTRIGLEDTLLLPDGAVADGNAALVAAAV
ELLSR
NT seq 738 nt   +upstreamnt  +downstreamnt
atggtgtgcatgccccccactccgcagacctatgtcaaggcgtgcatcaacggcgtccgt
acccccgaccagcatccgaacctgccggtcacgcccgatgaactggcggccgaagcggtg
gccgcccaccgggcgggggccaaagccgtgcacatgcatccgaagaacgccgacggcgtc
gactcactgcacgccgccgaggtcgacgccgcggtggccgcggtgcggcaggcgctgccg
gggctgccgctgggcgtgacgaccggattctgggcgttgcccgatccggggcaacgcctg
cgggcggtgcagagctggactgtgctgccggacttcgcgtcgctgaactggcacgaaccc
ggttcgccggagctggccgacgtgctgctgggccgcgggctcggcgtggaggtcgggatc
ttccacgccgaggcggcgcaggcctgggcggcgtccgacatcgcggcgcactgcatgcgc
gtgatgatcgagctgggcgccgacggtgacgtgtcgacggccgacgagctgctgggcatc
atcgcctcggccggctcgccggcgccggtgttgttgcacgggctcgacgaaagttgttgg
ccgctactggaacatgcgggtgcgcggggcgtgcagacgcggatcggactggaggacaca
ctgctgctgccggacggcgccgtcgccgacggcaacgccgcgctggtcgcggccgcggtc
gaattgctcagtcggtag

DBGET integrated database retrieval system