KEGG   Mycolicibacterium vaccae: MYVA_5422Help
Entry
MYVA_5422         CDS       T04356                                 

Gene name
ligC1
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mvq  Mycolicibacterium vaccae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANI42464
LinkDB All DBs
Position
complement(5650267..5651349)
Genome map
AA seq 360 aa AA seqDB search
MDTVQLPVTPPLEPMLAKAQTAVPDQPGVWSYEPKWDGFRALAFRDGDEVVLLSRSGKDL
ARYFPEVLDAVRDELAPRCVLDGEIVVPREIAADARNKAGRSRTRLDWESLSQRIHPAES
RIRMLSELTPAHFIGFDALAVGDTSLLKEPFRNRREALVGAVNHKQWCHVTRTTEDPALG
ARWLDEFEGAGLDGIIAKRLDGPYLPGKREMVKVKHHRDADCVAIGYRIHKSGEGIGSIL
LGLYREDGELQMVGGAASFTAKARLKLLADLEPLRIGDDMRDGEPSRWNSAADKRWIPVR
PERVCEVAYDQMEGNTDDGRRFRHAVRFLRWRPDRDPASCTFDQLDVPLTYDLYDVLESS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtgcagctgcccgtgacaccaccgctggagccgatgctggccaaggcgcag
accgcggtgcccgaccagccgggcgtctggtcctatgaacccaagtgggacgggttccgc
gcgctggccttccgcgacggcgatgaggtcgtgctgctgtcgcgcagcggcaaggacctg
gcccgctacttccccgaggtgctcgacgcggtgcgcgacgaactcgcgccccgctgtgtc
ctggacggagagatcgtcgtcccgcgcgagatcgccgcggacgcgaggaacaaggcaggc
aggagccggacccgactggactgggaatcgctgagccagcgcatccatcccgcggagtcc
cggatccggatgctgtccgaactgacacccgcgcacttcatcggtttcgacgcgctggcc
gtcggtgacacctcgctgctgaaggagccgttccggaaccgccgggaggcgctcgtcggc
gcggtgaatcacaagcagtggtgtcacgtcacccgcaccaccgaggaccccgcactcggg
gcgcgctggctcgacgagttcgagggggccggactcgacggcatcatcgccaagcggctc
gacggaccgtacctgccgggcaagcgcgagatggtgaaggtcaaacaccaccgggacgcc
gactgcgtggcgatcgggtatcgcatccacaagagcggggagggcatcggctcgatcctg
ctcggcctctaccgcgaggacggcgaactccagatggtcggcggcgctgcgtcgttcacc
gccaaggcgcgattgaagctgctggccgacctggaacccctgcgcatcggcgacgacatg
cgcgacggcgagccgagccgatggaactccgcggccgacaaacgctggatcccggtgcgg
cccgagcgggtctgcgaagtcgcctacgaccagatggaaggcaacaccgacgacggccgc
aggttccggcacgcggtgaggttcctgcgctggcgaccggaccgggatccggcgagttgc
accttcgaccagctcgacgtgccgttgacctacgacctctacgacgtgttggagagctcc
tga

DBGET integrated database retrieval system