KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_12340Help
Entry
X781_12340        CDS       T03026                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00240  Pyrimidine metabolism
mvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    X781_12340
Enzymes [BR:mvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     X781_12340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AHG73382
UniProt: W0Q571
LinkDB All DBs
Position
1251067..1251648
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVSSRIGISQEAT
LFNAETDLFAEIKQSHNNKTLHCILIDESQFLTKAQVYQLTDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVIRLNEKGEAIKEGEQIQIGGNDKYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttttactactcatcaatgaatgcgggcaaatcgactacgctactt
caatcttcttataattatcaagaacgtggtatgaatacattagtttataccgctgcgatt
gatgaccgttttggtgttgggaaagtcagttctcgtattggtatttctcaagaggcgaca
ttatttaatgctgaaactgatttatttgcagaaattaagcaatctcacaacaataaaacg
ttacactgtatcttaattgatgaatctcaatttcttactaaagctcaagtttaccagctt
actgatgtggttgataaattaaaaattcctgtactctgctatggattacgcactgatttc
caagcagaattatttgaagggagtaaatatttattggcgtgggcagatgaattagaagag
ctaaaaactatctgtgattgtggtaaaaaagctcatttcgttattcgtttaaacgagaaa
ggcgaagcaattaaagaaggagaacaaatccaaattggcggtaatgataaatatctttca
gtctgtcgttatcactacaagcaaaaattgggtaagttataa

DBGET integrated database retrieval system