KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_16820Help
Entry
X781_16820        CDS       T03026                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvr01100  Metabolic pathways
mvr01110  Biosynthesis of secondary metabolites
mvr01130  Biosynthesis of antibiotics
mvr01230  Biosynthesis of amino acids
Module
mvr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    X781_16820
Enzymes [BR:mvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     X781_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_33 AAA_18 Cytidylate_kin Thymidylate_kin AAA_17
Motif
Other DBs
NCBI-ProteinID: AHG73830
UniProt: W0Q7I4
LinkDB All DBs
Position
complement(1720258..1720746)
Genome map
AA seq 162 aa AA seqDB search
MGAGKSTIGRQLAQTLGMEFLDSDSVIEERAGADIDWIFDVEGEAGFRKREERILNELTQ
NHGIVLSTGGGSILSKDNRNVLSARGIVIYLETTVDKQFERTQRDKKRPLLQTEDPRKTL
EELAKIRNPLYEEIADITIHTDEQSAKVVANQIIDMMDNLVA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgggggctggaaagagcacaattggtcgccaactggctcaaacattaggaatggaattt
ttggattccgacagcgtgattgaagaaagagccggtgcagatattgattggatctttgat
gttgaaggtgaagcgggttttcgcaagcgtgaagagcgtatcctgaacgaattaacgcaa
aatcacggtattgtgctttcaacgggcggtggctctattttgtcaaaagataaccgcaat
gtattatcggctcgtggtatcgtgatctacttagaaacaacggtagataagcaatttgag
cgtacgcaacgtgataaaaaacgccctctgttacaaacagaagatccacgtaaaacatta
gaagaattagcgaaaatccgcaatccgctttatgaagaaattgcggatatcactatccat
actgatgaacaaagtgcaaaagtggttgcaaatcaaatcattgatatgatggataattta
gtcgcatag

DBGET integrated database retrieval system