KEGG   Mannheimia sp. USDA-ARS-USMARC-1261: X781_920Help
Entry
X781_920          CDS       T03026                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mvr  Mannheimia sp. USDA-ARS-USMARC-1261
Pathway
mvr00564  Glycerophospholipid metabolism
mvr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X781_920
Enzymes [BR:mvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     X781_920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA HI0933_like Pyr_redox_3 Thi4 YbjQ_1 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AHG72242
UniProt: W0Q1W2
LinkDB All DBs
Position
complement(99704..101296)
Genome map
AA seq 530 aa AA seqDB search
MQRNQQLAQVQQTQKWDFIIIGGGASGLGIAVDTASRGYKTLLLESHDFAKGTSSRSTKL
VHGGVRYLANGDVALVREALRERGRLAKNAAHLFKNQSFIIPNYTLKDCLMYRVGLGMYD
MLSGNLSLGKTQNIDKAEAKRRLPTLNDLGLRAGTVYQDGQFDDARLAVNMAQTVVEQGG
TVLNHAKVTSLHKTPQGKIDGVTFYDELNQQEHTVFGTAVINATGVFMNDILSMDHGSPK
KFVVPSQGIHLVLDKSFLPSNDALMIPKTSDGRVLFAVPWHDVLVVGTTDTLIEHPSYEP
IPLEQEVNFILTTAGQYLTKKPTRDDVKAVFAGQRPLAAPEKEGQSTKEVSRSHKVLTDP
TSGLVTITGGKWTTYRQMAEDTVEEALKVHPQLGNKPCRTVDLSIHGNIPAELVNLQDHL
YVYGSDIPELRGLMTAYPEYAEKLHPRLDYTVAEVIWAVRNEMAQTVEDVLARRVRLLFT
DARAAIDSAAKVAAIMAKEMGKDEVWQQAQVSQFLEVAKHYLLVDYQPQN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaatcaacaactcgctcaagtgcaacaaacgcaaaaatgggatttcattatt
attggtggtggtgcaagcggtttaggtattgcagtagataccgcctctcgtggctataaa
accttattgttagaaagccacgacttcgctaaagggacatcaagccgtagtactaaatta
gtacacggtggtgtgcgttatttagccaatggtgatgtcgcattagtaagagaggcattg
cgtgaacgtggtcgcttagctaaaaatgcggctcacctctttaaaaaccaaagtttcatt
attccaaactacacccttaaagattgtttaatgtaccgtgttggtttaggaatgtacgat
atgctttcaggcaatctcagtttaggtaaaacccaaaacattgataaagctgaagcaaaa
agacgtttaccaacattaaacgatttgggtttgcgtgcaggaacagtttatcaagacgga
caatttgatgatgctcgtttagccgtaaatatggctcaaacagtggtagaacaaggcgga
acagtgctaaaccacgctaaagtaacgtcattgcacaaaacaccacagggcaaaattgat
ggcgtaactttctacgatgagctaaaccaacaagagcatacagtatttggtacagcagtg
attaatgcaaccggcgtatttatgaatgatattttaagtatggatcacggcagcccgaaa
aaattcgttgtgccaagtcaagggattcacttagtgttagataaatcattcttaccaagt
aatgatgcattaatgattcctaaaacctcagacggtcgtgtgctattcgctgtgccttgg
cacgatgtgctagtcgtaggcacaacggatacgttaatcgaacacccatcttacgaacct
attccgttagaacaagaggtaaactttattttaactactgctgggcaatatctgacaaaa
aaaccaacccgagatgatgtaaaagccgtattcgcaggacaacgcccgcttgctgcacct
gaaaaagaaggtcaaagcacgaaagaggtttctcgtagccataaagttttaaccgacccg
actagtggcttggttactatcacaggtggtaaatggacaacttatcgccaaatggcagaa
gatacggtggaagaagcattaaaagttcacccacaattaggcaacaaaccttgtagaacg
gtcgatttatctattcacggtaatattccagcagaattagttaatttacaagatcatctc
tacgtttatggttcagacattccggaactacgaggcttaatgaccgcttaccctgaatat
gcggaaaaactccacccaagattggattacactgtggctgaagtgatttgggcggttcgt
aatgagatggctcaaacagtagaagatgtattagcacgccgcgttcgcttactctttact
gatgcaagagctgcaattgacagtgcagctaaagttgctgcaattatggcgaaagaaatg
ggtaaagatgaagtgtggcaacaagcccaagtatctcaattccttgaagtggcaaaacac
tacttacttgtggattaccaaccgcaaaattaa

DBGET integrated database retrieval system