KEGG   Moritella viscosa: MVIS_1717Help
Entry
MVIS_1717         CDS       T03770                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mvs  Moritella viscosa
Pathway
mvs00500  Starch and sucrose metabolism
mvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MVIS_1717
Enzymes [BR:mvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MVIS_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: CED59690
UniProt: A0A090IBZ6
LinkDB All DBs
Position
1:1958311..1959735
Genome map
AA seq 474 aa AA seqDB search
MKRNLRFVSNSIIKILLGATFLLGAQSNVYADTILHAFNWKYSDITSQAQNIAKAGYKKV
LVSPPLKSSGKEWWARYQPQDIRLIDSPLGNKEDLQTLISALKKEGVDVYADIVLNHMAN
ESWKRSDLNYPGRELLNQYSKNSEYINKQKLFGDLSKGIFSSFDFHPAGCISDYGDPGNV
QYWRLCGNDKDTGLPDLDPSDYVIKQQRQYLQSLKSMGIKGFRIDAVKHMSDYQVNQIFT
SDITSGMHVFGEVITTGGKGDSQYHTFLEPYLNNTNHGAYDFPLFASIRSAFSYDGSMSL
LHDPQEYGQALPGDRAITFTITHDIPTNDGFRYQIMTPINEKLAYAYILGKDGGSPLIYS
DALSDDEDKDNRRWEDVWNRDYMVKMISFHNDMKGKQMDTLYSDKCMLIFKRDKSGLVAI
NKCSEERSYTIDTYKTELNWYVPYKDRLSSHRETITSRYHKLSVPGQTTRMLAL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacttacgatttgtatcaaactcaataataaaaattttgttaggtgctact
tttctgcttggagcgcaaagcaatgtttacgctgacactattcttcatgcttttaattgg
aaatatagtgacatcactagtcaggcccagaatattgcaaaagcaggttataaaaaagtc
ttagtatctccaccattaaaatcttcagggaaagagtggtgggcacgttaccagcctcaa
gatattcgcttaattgactcacctttaggtaataaagaagatttacagacgttaatttca
gcgcttaaaaaggaaggtgtagacgtatacgcagacatagttttaaatcatatggctaat
gagagttggaaaagaagtgatctaaactatcccggtagagagttgttaaatcagtatagt
aaaaacagtgagtatataaacaagcaaaagctttttggagatctaagtaaagggatattt
tctagttttgactttcatcctgcaggctgtatatctgattatggcgatcctggaaatgta
caatactggagattgtgtggtaacgataaagatacagggctaccagatctagatccaagt
gattatgtcattaagcaacagcgtcaatatcttcaatctttaaaaagtatgggaataaaa
ggctttaggattgatgccgttaagcatatgagtgattatcaagttaaccaaatatttacg
tctgatataacgtcgggaatgcatgtttttggtgaagtaattacaacaggtggtaagggt
gattctcagtatcatacatttcttgaaccatatttgaataacacgaatcatggtgcatat
gattttcctttatttgcttctataaggtctgcattctcttatgatggaagcatgtcttta
cttcatgacccacaagaatatggccaagcattgcctggtgatagagccatcacctttact
attacgcatgatattccgacgaatgatggttttcgttatcaaataatgactcctattaat
gaaaaattagcttatgcctatattttaggtaaggatggtggatctcctttaatttatagt
gacgctctttctgatgatgaagataaagataatcgtcgatgggaggatgtttggaatcgt
gattatatggttaaaatgattagctttcataatgatatgaaagggaaacagatggacact
ttatatagtgataagtgcatgctcatttttaagcgtgataaaagtggattagtcgctata
aataaatgttctgaagagcgttcatatactattgatacatataagacggagcttaattgg
tatgtgccgtataaggataggttaagtagtcatcgcgaaactattacatctcgttatcat
aaattatctgtgccagggcagactaccagaatgcttgctctttaa

DBGET integrated database retrieval system