KEGG   Methanocaldococcus vulcanius: Metvu_0151Help
Entry
Metvu_0151        CDS       T01105                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00680  Methane metabolism
mvu01100  Metabolic pathways
mvu01120  Microbial metabolism in diverse environments
mvu01200  Carbon metabolism
Module
mvu_M00567  Methanogenesis, CO2 => methane
mvu_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mvu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Metvu_0151
Enzymes [BR:mvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Metvu_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: ACX72019
UniProt: C9REL7
LinkDB All DBs
Position
156668..157360
Genome map
AA seq 230 aa AA seqDB search
MDAISAIIPLIEITAAGAIINASVHFIPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLLG
AAVMSATVGLSPIGMTLIMISGAISSMIMLGVTMLIGQLIYVFGVGVVPAADKCEIDPIT
KDPQKPYVTPGTTGHGIPTVCFISGLIGAALGGIGGALAYIALRKLGLEPGVAGMLAVGF
FFINAVIASYNIGGTIEGFHDPKFKKLPNGVIASTIASILFGIISVLMVL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaattagtgcgattattccattgattgaaataacagcggcaggagcaataatt
aacgcaagcgttcacttcatccctgtcggaggagctccagcggctatggctacatcaaca
ggggtcgggacaggaacaactcagttagcagcaggagcaggttttactggattgttagga
gctgcggtaatgtctgctactgttggtctttctccgattgggatgacgttaatcatgatc
tctggagcaattagttctatgatcatgcttggagttactatgttgataggtcagttgatc
tatgtgtttggagttggagtagttcctgcagcagataagtgtgaaatcgatccaataacc
aaagatccacagaagccatatgttactccaggaaccactgggcatgggatcccaactgtt
tgttttattagtggattgataggagctgcattaggaggaattggaggggctttggcatac
attgctttgagaaaacttggtttagaaccaggagttgcaggaatgttagcggttggattt
ttctttataaatgcggttattgcatcatataacatcggaggaactattgaaggattccac
gatccaaagttcaaaaaacttccaaatggagttattgcatcaacaatagcatctatattg
tttggaataatatctgtcttgatggtattataa

DBGET integrated database retrieval system