KEGG   Methanocaldococcus vulcanius: Metvu_0984Help
Entry
Metvu_0984        CDS       T01105                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00630  Glyoxylate and dicarboxylate metabolism
mvu01100  Metabolic pathways
mvu01120  Microbial metabolism in diverse environments
mvu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Metvu_0984
Enzymes [BR:mvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Metvu_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACX72842
UniProt: C9RGZ0
LinkDB All DBs
Position
complement(968553..969830)
Genome map
AA seq 425 aa AA seqDB search
MDYINLNYTPKESDLLSCMIIKGDDLKKLANEIAGESSIGTWTKVQTMKSDIYEKLKPNV
YEIKEIGNDGKYKIGLIKIAYPLYDFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPK
EFIDEYEGPEYGIEGVRNTLKIKERPLLGTIVKPKVGLKTEEHAKVAYEAWVGGVDLVKD
DENLTSQDFNKFEDRVYKTLEMRDKAEEETGERKAYMPNITAPYNEMIRRAEIAEDAESE
YVMIDVVVSGFSAVQSFREENFGFIIHAHRAMHAAMTRSKDFGITMLTLAKIYRLLGVDQ
LHIGTVVGKMEGEEREVKAIRDEIVYDKVEADNEHKFFEQEWFGLNSVFPVSSGGVHPRL
VPKIVEILGRDVIIQAGGGIHGHPDGTRAGAKAMRAAIEAVMEGKPLEEKAEEVIELKKA
LEYWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggattacataaacctaaactacactccaaaagaaagtgatctgctatcttgcatgatc
attaaaggagatgacctaaaaaaattagcaaatgaaatcgctggagagagttccattgga
acatggacaaaagtccaaacaatgaaaagcgatatttatgaaaaactaaaaccaaacgtt
tatgaaattaaagaaattgggaatgatggaaaatacaagattgggttaattaaaattgct
tatccactatatgattttgaaataaataacatgcctggtgttttagcaggaatcgctggg
aatatttttggtatgaagattgcaaaaggtttaagaatattggattttagatttccgaaa
gagtttattgacgaatatgaagggccagagtatggtattgaaggagtaagaaatacctta
aaaatcaaagaaagaccgctattgggaaccatcgttaaaccaaaggttggattaaaaaca
gaagagcatgcaaaagttgcttatgaggcatgggttggaggagttgatttagttaaagat
gatgaaaacttaacttctcaggactttaataaatttgaagatagagtttataaaacatta
gaaatgagagataaagcagaagaagagacaggagagagaaaggcatacatgcctaacatt
accgctccatataatgagatgataagaagagcagagatcgctgaagatgcagaaagtgag
tatgtaatgattgatgttgttgtttctggattttctgctgtgcaatcatttagagaggag
aactttggattcataattcatgctcatagggcaatgcatgcagcaatgacaaggagcaag
gattttggaatcactatgttaactctggcaaaaatatatcgacttttgggagttgatcag
ttgcatattggaacagtagttggaaaaatggagggagaggagagagaagttaaagcgatc
agagatgagatcgtttatgataaagttgaggcagacaatgaacataagttttttgaacag
gaatggtttggcttgaacagtgtgtttcctgtctcttccggaggggttcatccaaggtta
gttcctaagatcgttgaaattctcggtagggatgtgatcatccaggcaggaggaggaatt
catggacatcctgatggaacgagagcaggagctaaggccatgagagcagctatcgaagcg
gttatggaaggaaaacctcttgaagaaaaagcagaagaagttatcgagttaaaaaaagcg
ttagaatattggaagtaa

DBGET integrated database retrieval system