KEGG   Methanocaldococcus vulcanius: Metvu_0999Help
Entry
Metvu_0999        CDS       T01105                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
mvu  Methanocaldococcus vulcanius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEGA Pkinase Pkinase_Tyr DUF2846 CarboxypepD_reg Kinase-like EntA_Immun APH Pkinase_fungal PEP-CTERM
Motif
Other DBs
NCBI-ProteinID: ACX72857
UniProt: C9RH05
LinkDB All DBs
Position
complement(986560..989154)
Genome map
AA seq 864 aa AA seqDB search
MKKLLLLIFYLILLSEISISYAELGTPELEISASVNPYKIEKGGTGTLIVNVSEVGGEDW
AKNVVVKPYCLDNGIFISPSKSSPVDIDKYGSATFTFTINVNNSALEGVKTIHIDVDYID
TGWLNIGEDDKSKSATTTFEVISSTSDTSNYPTNDYSYNSDGYISVDSNVYDADVYVDGS
YIGKTPIADYPITSGSHTISVEKEGYESYTEYVNVNSGETYNIYATLTESYGCLNVYSNP
TDADVYVDGYYEGKTPLHLTLTPGIHSVEVKKDEYYPYSTDVYINSGDSKTVNAELKPKF
GYLTVYSLEGAEIYIDGKYVGHPPLRSYKLSIGNHNIEIKKEEYNTYSTDIYINSGDSKT
IKAKLTPKYGYLTVYSYLGVPCDIYLNNKWIGTTPITKHDVKPGFYHIECKIGELPIYES
SISIKNGEYKKLDIELTNSYAGYYLGGSFALMGFGVVGLVLVRKRKQKNIGEKQNQDIFD
FPSELLSKYTPLEKLGEGGFGKVFKVKRKSDGEIIALKIPNLDEKAKKYLLKEIKVWQNL
NHPNIVRMFDAYEEPIPHIEMEYIDGYNLNGKLIRDLDKYPKPLSPKEAINLIKQIAEGL
KHAHDKNIIHRDIKPSNILLTPNLIPKITDWGLAKIGAKSSTATTTKALTLLYSAPEQID
EEEYGKTDKRTDIYQLGVLFYELLTGRLPYEGTSPAQISLKIVNPDKKPLPPSKINPSLS
IFDGLFERHLAKRKEDRFQSIDEFLRALKSIEELIKEKESLKKTLTQTIDKLKKSTDKKE
IERLIRELVDSTTKLALNCAKANDKVGLLEALETLKDYVKSENNKKELGGAIKHIEYLIK
EQIPIEKQTIEALEVLLNRIRREF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgttattgttaatattttatttaatattattgtcagaaattagtatatct
tatgcagaattaggaacaccagagttagaaatatctgcatcagtaaatccctataaaatt
gaaaaaggaggaactggaacgttgatagtaaatgttagtgaagttggaggggaagattgg
gcaaaaaatgttgttgtaaaaccttattgtttagataacggtatttttatttcaccttct
aaatcttcacctgtagatattgacaagtatggttcagcaacctttacattcaccataaac
gttaacaacagtgcgttagaaggtgtaaaaacaatacacattgatgttgattacatagac
acaggatggttaaatattggggaagatgataaatcaaaatctgcaactactacatttgaa
gtaatatcttccacatctgatacatcaaattatccaactaatgattattcttataattca
gatggatacatttcagtggattcaaatgtttacgatgcagatgtgtatgtggatggatca
tatattggaaaaactcccatagcggattatcctataacctccggaagccatacgatctct
gttgaaaaggaaggttatgagtcatatactgaatatgttaatgtgaattcgggagaaacc
tacaacatatatgccacattgacagaatcttatggttgcttaaatgtttattccaatcca
acagatgcagatgtttatgttgatggatattatgaaggaaaaacacctctccatttaaca
ttaactccaggaatacattcagttgaagttaaaaaagatgaatattacccctactcaaca
gatgtttatataaacagtggagattcaaaaacagtaaacgctgaattaaaaccaaagttc
gggtatttaaccgtttattcattagaaggagcagagatttatatcgatggtaagtatgta
ggacacccacctttaagaagttataagctatcaatagggaatcataacatagaaattaaa
aaagaggagtataatacatattcaacagatatttatataaacagtggagattcgaaaacg
ataaaggccaaactaacaccaaaatatggatatttaaccgtttattcctatctgggagtt
ccttgtgatatatatcttaacaataaatggataggaactactccaataaccaaacatgat
gttaaacccggattttatcatattgaatgtaaaatcggagaacttccaatatatgaatct
tcaatatctattaaaaatggagagtataaaaaattagatatagaattaacaaacagctat
gcaggatattatttaggaggatcgtttgcgttgatggggtttggagttgttgggttagta
ttagttagaaaaagaaaacaaaaaaatatcggtgaaaaacaaaatcaggatatttttgat
ttcccctcagaattgttatctaaatacaccccattagaaaaactcggggaaggtggtttt
ggaaaagttttcaaagttaaaagaaaatctgatggagaaattattgctttaaaaattcct
aatttagatgaaaaagctaaaaaatacctactaaaagaaattaaggtctggcaaaaccta
aatcatccaaatatagttagaatgttcgatgcttatgaagaaccaataccgcacattgaa
atggaatacattgacggctataacctcaacggcaaactaattagagatttagataagtat
ccaaaaccattaagtcctaaagaggcgataaatctaattaaacaaattgcagaaggttta
aagcatgcccatgataaaaacatcatccacagagatataaaaccttcaaacatcttgtta
acccctaacttaatcccaaaaataactgactggggattagcaaaaataggggctaaatca
tcaacagcaacaactactaaggcgttaactcttctatattcagcaccggagcagatagat
gaggaagagtatggaaagacagataaaagaacagacatatatcagttaggtgtcttattc
tatgagttattaactggaagattgccttatgaaggcacttcaccagctcaaatatcttta
aaaatagttaatccagataaaaaacctctccctccttcaaaaataaatccttctctatct
atattcgatggtttgtttgaaagacacttggcaaagagaaaagaagatagattccagtca
atagatgagtttttaagggcattaaaatctatagaagagttaataaaagaaaaagaatct
cttaagaaaacactaactcaaacaatagataaactcaaaaaatcaactgacaaaaaagag
attgagagattaatcagagagttagttgattcgacaacaaaattagctctaaattgtgca
aaggcaaatgataaagttggtttattggaggcattagaaacattaaaggattatgttaaa
tcagaaaataataaaaaagaattagggggagctataaaacatattgagtatttaataaaa
gagcagataccaatagaaaaacaaacaattgaagcattagaagttttattgaataggatt
aggagagagttttaa

DBGET integrated database retrieval system