KEGG   Microcystis viridis: myaer102_31870
Entry
myaer102_31870    CDS       T06032                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mvz  Microcystis viridis
Pathway
mvz00010  Glycolysis / Gluconeogenesis
mvz00020  Citrate cycle (TCA cycle)
mvz00620  Pyruvate metabolism
mvz01100  Metabolic pathways
mvz01110  Biosynthesis of secondary metabolites
mvz01120  Microbial metabolism in diverse environments
mvz01200  Carbon metabolism
Module
mvz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mvz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    myaer102_31870
   00020 Citrate cycle (TCA cycle)
    myaer102_31870
   00620 Pyruvate metabolism
    myaer102_31870
Enzymes [BR:mvz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     myaer102_31870
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p Biotin_lipoyl_2 DUF4781
Other DBs
NCBI-ProteinID: BBH40617
UniProt: A0A3G9JXA9
LinkDB
Position
complement(3387773..3389032)
AA seq 419 aa
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEEEIELAKAQGKTAATAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNSSYSDAGIQYHGAINVAVAVAMPDGGLITPVLRS
ANQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtagtcgaa
tccgacaaggccgacatggacgtagaatcgttttatgatggttatctcgctgtaatttta
gtcgaagccggccaggaagcacccgtgggggaagcgatcgcctatattgccgaaactgaa
gaggaaattgaactggccaaagctcagggaaaaaccgccgcaaccgcccctagcaagcct
gtagagaccccagaaatcgctccgcctcccgtttcgatccccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtggat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcctgtcattactcccccgcaacccgtcagc
gtccctgtagcggctcctaaagccccgattccaaccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagctgtcgctcagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccaccgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtagccaacaccctcgct
aaacatcctatagttaattccagctatagcgatgcaggaattcaataccacggggcgatt
aacgtcgctgtcgccgtagctatgcccgatggtggcttaattacgccggttttgcgctct
gctaaccagatggatatctattccctctcccgcagttggaaagatttagtcgatcgcgcc
cgcagtaaacaactgcaaccggaagaatacaatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggcgcaatcctg
gccgtgggtgcttcccgtccccaaatcgtcgtcaataaagatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgctgcc
tcctttctgcaagacttggctaaactgatcgaaactgaggtgcagtccttaactatgtaa

DBGET integrated database retrieval system