KEGG   Microcystis viridis: myaer102_31870Help
Entry
myaer102_31870    CDS       T06032                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mvz  Microcystis viridis
Pathway
mvz00010  Glycolysis / Gluconeogenesis
mvz00020  Citrate cycle (TCA cycle)
mvz00620  Pyruvate metabolism
mvz01100  Metabolic pathways
mvz01110  Biosynthesis of secondary metabolites
mvz01120  Microbial metabolism in diverse environments
mvz01130  Biosynthesis of antibiotics
mvz01200  Carbon metabolism
Module
mvz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mvz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    myaer102_31870
   00020 Citrate cycle (TCA cycle)
    myaer102_31870
   00620 Pyruvate metabolism
    myaer102_31870
Enzymes [BR:mvz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     myaer102_31870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: BBH40617
UniProt: A0A3G9JXA9
LinkDB All DBs
Position
complement(3387773..3389032)
Genome map
AA seq 419 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEEEIELAKAQGKTAATAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNSSYSDAGIQYHGAINVAVAVAMPDGGLITPVLRS
ANQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtagtcgaa
tccgacaaggccgacatggacgtagaatcgttttatgatggttatctcgctgtaatttta
gtcgaagccggccaggaagcacccgtgggggaagcgatcgcctatattgccgaaactgaa
gaggaaattgaactggccaaagctcagggaaaaaccgccgcaaccgcccctagcaagcct
gtagagaccccagaaatcgctccgcctcccgtttcgatccccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtggat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcctgtcattactcccccgcaacccgtcagc
gtccctgtagcggctcctaaagccccgattccaaccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagctgtcgctcagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccaccgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtagccaacaccctcgct
aaacatcctatagttaattccagctatagcgatgcaggaattcaataccacggggcgatt
aacgtcgctgtcgccgtagctatgcccgatggtggcttaattacgccggttttgcgctct
gctaaccagatggatatctattccctctcccgcagttggaaagatttagtcgatcgcgcc
cgcagtaaacaactgcaaccggaagaatacaatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggcgcaatcctg
gccgtgggtgcttcccgtccccaaatcgtcgtcaataaagatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgctgcc
tcctttctgcaagacttggctaaactgatcgaaactgaggtgcagtccttaactatgtaa

DBGET integrated database retrieval system