KEGG   Microcystis viridis: myaer102_33370Help
Entry
myaer102_33370    CDS       T06032                                 

Definition
(GenBank) HAD-superfamily hydrolase subfamily IA, variant 3
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
mvz  Microcystis viridis
Pathway
mvz00630  Glyoxylate and dicarboxylate metabolism
mvz01100  Metabolic pathways
mvz01110  Biosynthesis of secondary metabolites
mvz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mvz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    myaer102_33370
Enzymes [BR:mvz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     myaer102_33370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_3 DUF3323
Motif
Other DBs
NCBI-ProteinID: BBH40753
UniProt: A0A3G9JJQ8
LinkDB All DBs
Position
complement(3585691..3586440)
Genome map
AA seq 249 aa AA seqDB search
MSIIRCGNREFRDIQGIVFDKDGTLEDSRAFWYDRAIARIQAIESRIPGLESLLTKTFGI
GANSLNPAGLMAVGSRRDNHIAAAGCIASTGRDWLTAIAIAKAAFQAADEKVPPRLNPLY
PQCLEVIRYLHAAGLQLAILSSDTTARVEQFVKENHLLNYIKIARGCDRGLSKPDPLLLQ
ETCQALGTPVDKTLMVGDTRADWEMAKQAKSAAAIAISWQPETHQDLQLADVVIRELTAI
SVISYDFSC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgataattcgctgtggtaatcgagaatttagagatattcaagggattgtttttgat
aaggacggtacgctagaggattcgcgggctttctggtacgatcgagctatagcccggata
caagccattgaatcgcggattccgggtttagagtctttattaactaaaactttcggtatt
ggggcaaatagtctcaatcctgctggtttaatggcagtgggcagccgcagagataatcat
atcgccgctgccggttgtattgcttccaccggtcgggattggttaacggctattgcgatc
gcaaaagcggccttccaagcggccgatgaaaaggttcccccccgcttaaatcccctctat
ccccaatgtttagaagtaattcgttatctgcacgcggccggtttacaattggcgattctt
tcctccgataccacagcacgagttgagcaatttgtcaaggaaaatcacctattaaattat
attaaaattgcccggggctgcgatcgaggtttaagtaaaccggatcccctattattgcaa
gaaacctgtcaagctttggggaccccagtggacaaaaccctgatggtgggggacactagg
gccgattgggaaatggctaaacaggcaaaatcagcagcagcgatcgcaattagttggcaa
ccggaaacccatcaagatttacaattagctgatgtggtcattagagaacttactgccatc
tcggttatcagttatgattttagctgttag

DBGET integrated database retrieval system