KEGG   Methanothermobacter wolfeii: MWSIV6_0011Help
Entry
MWSIV6_0011       CDS       T04587                                 

Gene name
fae-hps
Definition
(GenBank) Bifunctional enzyme Fae/Hps {ECO:0000255|HAMAP-Rule:MF_01268}
  KO
K13812  bifunctional enzyme Fae/Hps [EC:4.2.1.147 4.1.2.43]
Organism
mwo  Methanothermobacter wolfeii
Pathway
mwo00030  Pentose phosphate pathway
mwo00680  Methane metabolism
mwo01100  Metabolic pathways
mwo01120  Microbial metabolism in diverse environments
mwo01200  Carbon metabolism
mwo01230  Biosynthesis of amino acids
Module
mwo_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MWSIV6_0011 (fae-hps)
  09102 Energy metabolism
   00680 Methane metabolism
    MWSIV6_0011 (fae-hps)
Enzymes [BR:mwo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     MWSIV6_0011 (fae-hps)
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.147  5,6,7,8-tetrahydromethanopterin hydro-lyase
     MWSIV6_0011 (fae-hps)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fae OMPdecase Ribul_P_3_epim TMP-TENI QRPTase_C Sld7_C
Motif
Other DBs
NCBI-ProteinID: SCM55508
UniProt: A0A1M4MPF4
LinkDB All DBs
Position
I:complement(8969..10189)
Genome map
AA seq 406 aa AA seqDB search
MYRIGEALIGSRNEVAHIDLIIGDKEGNAGAAFANGLTNLSLGHTPLLSVIRPNLMTKPA
TLIVPKVTVSCLEDADKIFGPAQTAVARAVADAVEEGIIPEEKAEDLVVIVSVFIHPDAE
DYRKIYQYNYGATKLALRRAMEGYPSIRKVITEKDRGSHPIMGFRAVRLWNPPYLQVALD
LDSMEEMERIIDSLPNRERILLEAGTPLVKKFGVGVVSRIRELRRDAFIIADLKTLDVGR
IEVKMAADETADAVAISGLGTVESIEKAIHEAQKQGIYSILDMMNVENFVEKLKGLKYKP
DIVLLHRNVDLETLRAERGEDIGDMSEWGNIREIKEILGPRGLVAVAGGITPSKMQEALE
SGADIIVVGRYIIGSRDVRRAAEDFLEHMPQDPDTMRLPLDEDEAI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgtacaggataggtgaagcattaataggaagcaggaatgaagtcgcccacatagacctc
atcataggggacaaggagggaaacgcaggagcggcctttgcaaacggcctcacaaacctc
tccctgggacacacccccctgctctcggtcataagacccaacctcatgaccaagccagcc
accctcatcgtgccgaaggtcacggtgagctgcctggaagacgctgataagatatttgga
ccagcacagacagccgttgcccgtgcagtggcagacgctgttgaagagggcatcatacct
gaagaaaaggcagaggaccttgttgtaattgtgagtgtgttcatacaccctgatgctgag
gattaccgcaagatataccagtacaactatggcgccaccaaactcgccctcagaagggcc
atggaaggttatccatcaataaggaaggtgataaccgagaaggatcgtggaagccatcca
atcatgggattccgcgccgttcgcctctggaacccaccatacctccaggtcgcccttgac
cttgacagcatggaggagatggagagaatcatcgattcactcccgaaccgggaaaggata
ctccttgaggccgggacacccctggttaaaaaattcggtgttggagtggtgagcaggata
agggaactccgcagggacgccttcataatagctgaccttaaaacactcgacgttggtaga
atagaggttaaaatggctgcagatgaaaccgcggatgctgtggccatatcaggccttgga
acggttgaatccattgagaaggccatacacgaggcccagaagcagggcatatactcaata
ctggacatgatgaacgttgagaacttcgttgagaaactgaagggccttaaatacaaaccg
gacatcgtcctgctccacaggaacgtggacctggaaaccctcagggccgaacgtggagaa
gacatcggtgatatgagtgaatggggtaatataagggagataaaggaaatcctgggtccc
aggggacttgttgcagtcgctggaggtataactccatccaagatgcaggaggcccttgaa
agcggcgccgatataatagtggttggaaggtacatcatcggctcaagggacgttagaagg
gccgctgaggacttccttgagcacatgccacaggacccagataccatgaggctaccgctg
gacgaagacgaagccatctag

DBGET integrated database retrieval system