KEGG   Methanothermobacter wolfeii: MWSIV6_1332Help
Entry
MWSIV6_1332       CDS       T04587                                 

Gene name
ppcA
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mwo  Methanothermobacter wolfeii
Pathway
mwo00620  Pyruvate metabolism
mwo00680  Methane metabolism
mwo00720  Carbon fixation pathways in prokaryotes
mwo01100  Metabolic pathways
mwo01120  Microbial metabolism in diverse environments
mwo01200  Carbon metabolism
Module
mwo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mwo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MWSIV6_1332 (ppcA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MWSIV6_1332 (ppcA)
   00680 Methane metabolism
    MWSIV6_1332 (ppcA)
Enzymes [BR:mwo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MWSIV6_1332 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: SCM57915
UniProt: A0A1M4MT98
LinkDB All DBs
Position
I:1234084..1235535
Genome map
AA seq 483 aa AA seqDB search
MNVPRCMSTQHPDNVNPPFFASGPELGGEDEIKEAYYVFSHLGCDEQMWDCEGKEVDSYV
VKKLLTEYESFFRENILGEDCRLTLRVPNPTVERAEAKILLETLESIPRSYDTAALFYER
DVPPVFEVILPMTASSRCLNRVYHYYRDFVAGKENLKLKDDVTVGEWIGEFRPEEINVIP
LFEDMDGMLAAGRITAEYLEGKDPEHQRVFLARSDPAMNYGMIPATLLNKVALQSLGEVE
EETSVIICPIIGMGSAPFRGNLKPSNTRAVEDYPGAFTFTVQSSFKFDHPPAEVSDAVRL
LREHKPGKPQDVDRERIIDIVNRYSSEYRRHVMRLADMINRVSRHVPGRRKRKLHIGLFG
YSRSMGGVSLPRAITFTAALYSIGVPPEILGFSSLTDPDLDYIMEIYPGFERDFHDALRY
MNPHSPHLPPELRSSIEEHFPDISHDPEHVRVTDEINHSLALNRTGNLQGRILEAASIRK
FLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttccaagatgcatgagcacacagcaccctgacaacgtgaaccccccattcttt
gcatcaggccctgaacttggaggggaggatgagataaaggaggcctactatgtattctca
caccttggctgtgatgagcagatgtgggactgtgagggtaaggaggtggacagttacgtt
gtcaagaagctcctcacagaatacgagtcattcttcagggagaacatcctcggcgaggac
tgcagactgacactcagggtccccaaccctacggtggaaagggccgaggcaaagatcctc
cttgaaacccttgagagcataccccgatcctatgatacggcagccctattctatgaaagg
gatgtgccgccggtatttgaggttatactccccatgacggcctcaagcaggtgccttaac
cgtgtctaccactactacagggacttcgtggccgggaaggagaacctgaagctcaaggat
gatgtgacggtgggtgaatggataggggagttccgtccagaggagataaacgtcatcccc
ctcttcgaggacatggacggtatgctggcagctgggaggataaccgccgagtaccttgag
ggcaaggaccctgaacatcagagggtgttccttgcaaggtccgaccctgcaatgaactac
gggatgatcccggccacactcctcaacaaggtcgccctccagtccctgggggaggttgag
gaggagacaagtgtcataatctgccccatcataggtatgggttcagcgcccttcaggggc
aacctgaaaccatcaaacacccgcgccgttgaggactaccctggtgccttcaccttcact
gtacagtcctccttcaagttcgaccatccccctgccgaggtcagcgatgccgtgaggctg
ctcagggaacataagcctggtaaaccccaggatgtggaccgggagaggataatcgatatt
gtgaaccgttactccagtgagtacaggaggcatgtcatgaggctcgctgatatgataaac
agggtttcaaggcacgtccccgggaggaggaagaggaagctccacattggactcttcggt
tactcgaggagtatgggaggggtttccctccccagggccataaccttcaccgcggccctc
tactccatcggggtgccccctgagatacttggtttcagctccctcacggaccctgacctt
gactacataatggagatctatcctggatttgagagggacttccatgatgccctcaggtac
atgaacccccattcaccccacctgccccctgaactcaggagctcaattgaggagcacttc
cctgacatcagccatgaccctgaacatgtaagggtgaccgacgagatcaaccactccctt
gcactcaacaggaccggtaacctgcagggcaggatactggaggctgcaagtataaggaag
ttcctggggtaa

DBGET integrated database retrieval system