KEGG   Methanothermobacter wolfeii: MWSIV6_1613Help
Entry
MWSIV6_1613       CDS       T04587                                 

Definition
(GenBank) putative protein MJ0414
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mwo  Methanothermobacter wolfeii
Brite
KEGG Orthology (KO) [BR:mwo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MWSIV6_1613
Enzymes [BR:mwo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MWSIV6_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: SCM58408
UniProt: A0A1M4MTZ1
LinkDB All DBs
Position
I:complement(1493111..1494241)
Genome map
AA seq 376 aa AA seqDB search
MKDIPFERISEKTGVPAERLETSFKKGSSRLLESGGLRALFFKKQVMDLEAGTVAYLTGE
PEVIRGFPKIRRTLLLSPAIEKHFTESVAVEEKMNGYNVRIASVSGRILALTRGGHVCPF
TTEKAKELMDLQEFFRDHGDLVICGEMIGRDNPYVSHDYPEVGPLGFRVFDIREKNTNTP
LPVMDKRRILESYELPAVRLFGIFPVEEAPGRVAEIIRMLGADGREGVVMKDPEMKLPPL
KYTSSQAHAREIVYAFNYSFDFGRPFFFSRVIREGFQAYELDESDEETLERAHRLGEAII
YPMLKRIKSIAEGEPACEDTVIDVEDRERAEEFLRHLSRLGVSATIADYRDGKATIRRFY
QSTTDRITNYLEGGLY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacataccattcgagaggatctcagagaagacaggggtcccggccgaaagactt
gaaacatcatttaagaagggcagcagccggctccttgaatcagggggcttaagggccctc
ttctttaagaagcaagtaatggaccttgaagcgggaaccgtagcctacctcacgggggaa
ccagaggttatacggggctttccaaagataaggaggacgctgctcctttcaccggccatc
gagaaacacttcactgaaagcgttgccgtggaggagaagatgaacggctacaatgtgcgg
atagcctctgtttcagggaggatccttgcacttacaaggggaggccatgtgtgcccattc
accacagagaaggccaaggagctcatggacctccaggaattcttcagggatcatggggac
cttgtaatatgcggggagatgatcggcagggacaacccctacgtctcacatgactaccct
gaggtgggccccctgggattcagggtctttgacatccgggagaaaaacaccaacacaccc
ctaccggtaatggataagagaaggatccttgaatcctatgaactcccggcggtcagactc
ttcggcattttcccggtggaggaggccccagggagggtggcggagataataaggatgctg
ggtgccgatggaagggagggggttgtcatgaaggaccctgaaatgaagctacccccactg
aagtacacatcatcccaggcccatgcacgggagatagtatacgccttcaactactccttc
gactttggaaggccattcttcttcagcagggttatacgtgaagggttccaggcatatgaa
ctggacgaatccgacgaggagacccttgaaagggcccaccgcctcggagaggccataata
taccccatgctgaagaggataaagagcatagctgagggcgaaccagcctgtgaggacacg
gttatagacgttgaggacagggaaagggccgaggaattcctcaggcacctatcacgcctt
ggtgtctcagcaaccattgcagactacagggacggtaaggcaaccataaggaggttctac
cagtcaacaaccgacaggataaccaattaccttgaggggggcctgtactga

DBGET integrated database retrieval system