KEGG   Myxococcus xanthus: MXAN_0917Help
Entry
MXAN_0917         CDS       T00366                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00380  Tryptophan metabolism
mxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MXAN_0917 (kynU)
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     MXAN_0917 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABF87345
UniProt: Q1DDU5
LinkDB All DBs
Position
complement(1047259..1048539)
Genome map
AA seq 426 aa AA seqDB search
MTTPYLFEDSESFARKLDAEDALRGYRDAFHFPPGPDGKPVVYLAGNSLGLQPRNAARYI
QEELEDWARLGVEGHHHGRHPWLHYHELVTEHAARLVGAKPLEVVVMNTLSVNLHLMMVS
FYRPTKQRFKILVEAGAFPSDQYAVASQVRFHGYDAREAVLELKPREGEETLRTEDILET
IERHGHEVALVMLGSVNYLTGQAFDLAAITKAAHAKGCFVGFDLAHGAGNLRLSLHDDGP
DFAVWCSYKYLNAGPGALGGVFVHERHAHTKDLPRFEGWWGHDKQTRFQMGPTFSALPGA
EGWQLSNPPIFQLAALRASLELFDQAGMAALRAKSERLTGYLEFLLDRLPEGFVRITTPR
DVKQRGAQLSLRFRGEPQGLLKRLGDAGIICDFRKPDIIRAAPAPLYNSFTDVYRFVKTL
EGHARE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccgtacctcttcgaggactccgagtccttcgcgcggaagttggacgcggaa
gacgcgctgcgcggctaccgcgacgcgttccacttcccgcccggcccggacggcaagccg
gtggtgtacctggcgggcaactcgctgggcctccagccgcgcaacgccgcgcgctacatc
caggaggagctggaggactgggcgcggctgggcgtggagggacaccaccacggccgccac
ccgtggctgcactaccacgagctcgtcaccgagcatgccgcgcggctggtgggcgccaag
ccgttggaagtggtggtgatgaacaccctgtcggtgaacctgcacctgatgatggtgtcg
ttctaccggcccacgaagcagcgcttcaaaatcctggtggaggccggcgccttcccgtcg
gaccagtacgccgtcgcctcccaggtgcgcttccacggctacgacgcgcgcgaggccgtg
ctggagctgaagccgcgcgagggcgaggagacgctgcgcaccgaggacatcctcgaaacc
attgagcgtcacggccacgaggtggcgctggtgatgctgggcagcgtgaactacctcacc
gggcaggcgttcgacctggccgcgattacgaaggccgcgcacgccaagggctgcttcgtc
ggcttcgacctggcgcacggcgcgggcaacctgaggttgtcgctgcacgacgacggaccg
gacttcgcggtgtggtgctcgtacaagtacctcaacgccggcccgggcgcgctgggcggc
gtgttcgtccatgagcggcacgcgcacacgaaggacctcccccgcttcgagggctggtgg
ggccacgacaagcagacgcgcttccagatggggcccaccttcagcgcgctgccgggcgcg
gaggggtggcagctgtccaacccgcccatcttccagctcgcggcgctgcgcgcgtccctg
gagctgttcgaccaggctggcatggcggcgctgcgcgccaagagcgagcggctcaccggc
tacctggagttcctgctggaccggctgcccgagggattcgtgcgcatcaccacgccccgg
gacgtgaagcagcgcggggcccagctctccctgcgcttccgcggcgagccccagggcctg
ctgaagcgcctgggagacgcgggcatcatctgcgacttccgcaagccggacatcatccgc
gccgcgcccgcgccgctctacaactccttcacggacgtgtaccgcttcgtgaagacgctg
gagggccacgcccgtgagtga

DBGET integrated database retrieval system