KEGG   Myxococcus xanthus: MXAN_3219Help
Entry
MXAN_3219         CDS       T00366                                 

Definition
(GenBank) putative phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01130  Biosynthesis of antibiotics
mxa01230  Biosynthesis of amino acids
Module
mxa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MXAN_3219
Enzymes [BR:mxa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     MXAN_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD
Motif
Other DBs
NCBI-ProteinID: ABF93106
UniProt: Q1D7F5
LinkDB All DBs
Position
3770875..3771993
Genome map
AA seq 372 aa AA seqDB search
MIVMLEPDSPESVVSAVLQVASQYKGVTPRTHVIGGSEYTITEVYLLGSTAQVPVEPFEQ
IPGVRQVVRVSQKYRVIGRHKGQRTSAGFEYNGVTFDERSVNVFAGLCAVDNPENVDTMM
AALARLGIRTTRMGAYKPRTNPYEFQGLGAACLPWVFESAGKHGIKVIAMEVTHPRHIDE
IRDALERSGNATGVMLQVGTRNAQNFELLKSIGQQRVFPVLFKRGMGITLEESLNACEYV
ASEGNPKIIFCLRGVKTHLGDPHRNMVDFAHVPVVRRLTRLPVCVDPSHAIGQAAPPPDG
LPDIFHAIGQGLIAGASMVLVDFHPHPEAALCDGPQALRMEQLPALQRYVQLVRSAYETA
VQSGDGLQATGA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcatgctcgagccggactcgcctgagtccgtggtgtccgccgtcctccaggtt
gcttcccagtacaagggagtgacgccgcggacgcacgtcatcggtggctccgagtacacg
attacggaggtctacctgctgggttccaccgcgcaggtgcccgtggagcccttcgagcag
attcccggcgtgcggcaggtggtgcgcgtgtcgcagaagtaccgcgtcatcgggcggcac
aagggccagcggacgtccgccggcttcgagtacaacggcgtcaccttcgacgagcgctcc
gtgaatgtgttcgctggcctgtgtgccgtggacaacccggagaacgtggacacgatgatg
gcggcgcttgctcgcttgggcatccgcaccacgcgcatgggcgcctacaagccccgcacc
aacccctacgagttccagggcctgggcgccgcctgcctgccctgggtgttcgaatccgcg
ggcaagcacggcatcaaggtcatcgcgatggaggtgacgcacccgcgtcacatcgacgag
attcgcgacgcgctcgagcgctccggcaacgccacgggcgtcatgctccaggtgggcacg
cgcaacgcgcagaacttcgagctgctcaagagcattggccagcagcgtgtcttcccggtg
ctcttcaagcgcggcatgggcatcaccctggaggagtcgctcaacgcgtgtgagtacgtg
gcgagcgagggcaatccgaaaatcatcttctgcctccgcggcgtgaagacgcacctgggt
gacccgcaccgcaacatggtggacttcgcccacgtgcccgtggtgcgccggctgacgcgc
ctgccggtgtgcgtggacccgtcgcacgccattggccaggccgcgccgccgccggacgga
ctgccggacatcttccacgccattggccaggggctcatcgcgggcgcgtccatggtgctg
gtggacttccacccgcacccggaggccgccctgtgtgacggcccccaggccctgcgcatg
gagcagctccccgcactgcagcgctacgtccaactggtgcgctccgcgtacgagacggcc
gtgcagagcggcgacgggctccaggccaccggcgcctga

DBGET integrated database retrieval system