KEGG   Myxococcus xanthus: MXAN_3634Help
Entry
MXAN_3634         CDS       T00366                                 

Definition
(GenBank) non-ribosomal peptide synthase
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ABF91141
UniProt: Q1D6A2
LinkDB All DBs
Position
4267093..4284318
Genome map
AA seq 5741 aa AA seqDB search
MLRVPPQRRSPAFPQLHPLEPLTMRSHPAATLLELLETQTQSLGERRLYTFLEDGGDDAV
LSYAGLDLRARRIGAALQALARAGERAVLLYPPGLEYVAGFFGCLYAGLVAVPAYPPDPM
RLERTLPRLRAIIRDARASVVLTTSFIQEMGEGLFEGAPELAALRWVATDALPEGTEAGW
RRPEPSRDTLAFLQYTSGSTGDPKGVQLSHGNLLHNLGLISHAFQVRSDSVGVIWLPPYH
DMGLIGGILQPLYAGFPVALMSPLAFLRRPRFWLESLSRFGGTISGGPCFAFDLCVRKVP
PAEREGLDLRRWELAFCGAEPIRPEVMTRFSEAFAPVGFQREALYPCYGLAEGTLIASGG
RKGEGVLTRMWDAQALERNEALAAEDGPGARPLVGCGQTLPEQTLLVVDPETRRACPPER
VGEIWVSGPSVAHGYWERPEESEAAFGARLADSDSGPRFLRTGDLGLLKDGELFVVGRRK
DLIILRGRNLHPQDLELTLERSHSALRPGCGAAFSIDVGGEERLAVMYEVDSRKPWTAED
VVGAVRRGLAETHEVQLHTLVLIEPGALPKTSSGKIQRRACRAELLAGTARALLTWSESE
ADAPQAKAPAPDITASQPLTVEALEAWLLARIASRLRVRPEELATDAPITSFGLDSLGAV
ELANDVETLGVVLRMEVLLQGPTVGALALTLFAARGASTGAELTRGEERTPAPLSSAQQR
LWLFEQLAQGSAAYHLPAAVRLTGALDDVALEHAFAAIVQRHAALRATFRDEDGTPSQVT
SSVPVSSLRRVDLRDVPVDAREEAALRLAHEEARAPFDLERGPLLRATLFQLDAHEHLLV
VVMHHIASDGASFAILARELSALYAGDVSLPPLAFQYPDFARWRREVEADGALATSLDWW
KARLAGGAAALELPADRSRPPMPSYRGGRVAVRFPEALTARLEALGRSEGATLFMTLLAA
FEVLLARHSGQADFCVGTAVNGRERAGLEGLMGCFLDLIVLRASVSGSSRFRELLGQTRE
GVLAAFAHRGVSFERLVDAVQPTRDPSRAPLFQVLFVLQPEPGAGLALPGLESRRVEVDP
GATPYDLTLSLARGPEGLGGWLEYATDLFDADTAARLVARLGVLLESIVADPDQRLAMLP
LLPEAEQRQVLVDWNDTRAEFPEACIHALVELQAQRTPDAVAVVCGDGVLTYRELNQRAN
AVAWRLREQGVGPECIVGLFADRSADLVVGLLGIFKAGGAYLPLDPSYPEARLALMLEDS
GASVVLAHRHLAGALPFGDRTVVPLDVAGEADAAPPGAVGPDNLAYVLYTSGSTGKPKGV
LIPHRNVVSFFTGMDARVGTEPGTWLAVTSVSFDISVLELLWTLARGFKVAVQGEQGALG
AAPRRVTRSRQKPLGFSLFYFAADEGAPGAERYRLLLEGARFADRHGFQAVWTPERHLHA
FGGLYPNPSVTSAAIAAITERVAIRAGSVVLPLHHPVRVAEEWSLVDNLSKGRVGISVAP
GWHADDFVLAPERYAERRELARRDLDTLRRLWRGESLSFPNGAGTPIDVRIRPSPVQREL
PVWLTAAGNPDTFREAGRLGAGVLTHLLGQRWEELESRIALYREAWREAGHEGEGHVTLM
LHTFVGHDVERVRETVEAPLRRYLSNSADLMRGLGRTLGVDLDPASVRPEDLDALVGRAF
GRFFDGAGLFGTPRTCREQVARIEALGVDEVACLIDFGVDTDAVLASLPALDAVRQRCER
DFRLQSQEEITVPAQLRRHGVTHLQCTPSLAQALLLEPGAAGALVGLERLLVGGEALSAE
LAERLRGTMGGALLNMYGPTETTIWSSSHAVDGSPGPVPIGTPIANTSLYVLDAELRPLP
VGVPGELYIGGMGVARGYHARPELTAERFLPDPASSNAGARMYRTGDRARWRADGTVEFL
GRVDHQLKVRGFRVEPGEIESVLARHSDVAQAVVVAREASAGGARLVAYVVARPGTALSV
EALLAFSRRSLPEHMVPSAFVPLDALPLTPNGKVDRKALPAPEGVRDVAREYVAPRTDTE
RRLAELWASLLGVERVGAEDDFFALGGHSLLATRAASRIREAFGVDLPLRELFESSSPAA
LGARIDARLLGASGVPPLVARSHEGALPLSFAQQRLWFLEQLEPGGAAYNDAVAVRVEGA
LDVALLERSLREVVRRHEVLRATFHDDGGTPSWRIHPEARLALDRVDLTALSGADQAEAL
SLRLAEESLRAFDLGAGPPLRATLLQVSAREHVLLLVLHHLVTDGASMGVLVLEVAALYR
AFSQGQVSPLSPLPLQYVDYAAWQRDWLRGEALEAQLAYWRTRLGGAPRALDLPTDRPRP
AVRSSRGVSRSMLLGPELSHALKTLAQREGATPFMVLLAGFSALLSRHGGQDDLCVGTPV
EGRDRTELEGLIGCFVNTLVLRVSLAGTPSFRELIGRARETVLGAFAHQDAPFEELVKAL
QPERDLGRSPLFQAMLVMQEDPLPELVIPGLRLNVQPQPSLTAKFDLRLIITDTADGFSA
NLELSTDLFEPDTATRLLEHLRVLLEAGVREPEQQVHALPLMTSAERHRVLVAWNDTDRP
RPGVSVLHRLIEARVDRTPDVVALSFESDTLTYRELDRRANQLARYLRARGVGPDTRVAL
CVERSLEMVVGLLGVLKAGGAYVPLDPEYPRERLEYMLADAAAPVLLTQARLSERLPRDS
ATVVCLDSEWDAVAREREERLDVTVDGSGLAYVLYTSGSTGRPKGAMNTHAAICNRLLWM
QEAYGLDSSDRVLQKTPFSFDVSVWEFFWPLLAGARLVMARPGGHREPAYLTDTIARERI
TTLHFVPSMLRPFLEETELAVSCASLRRVFCSGEALPPELRDRYFSCLLAELHNLYGPTE
AAVDVTAWACAREDRGHVVPIGRPIANARMYVLDARLRPVPAGVPGELYIGGAPLARGYW
QRPDLTAERFLPDAFAAQPGARMYRTGDQARFLANGAIEYLGRLDDQVKLRGFRIELGEI
EAVLSLHPGVRAAAVAIREDVPGDRRLVAYVVAPSGDVASELRAFLGERLPEHMVPSAFV
TLDALPLSPSGKLDRRGLPAPVRAVQGRGAAHVEPRNALELEIAQIWAGVLGVERVGAED
RFFELGGDSILALQVIARARQVGIHLTARQLFQHPTVAGLAQVATSRRRLGDQGPVVGPV
PLTPIQRWFVERELPEAHHFNQALMLEPRERLESDVLACALRALVDHHDALRLRLSRSDT
GWAQSCAEPGRDVPLRLVDLSGLDAAARAVAMERTATEEQAGLDLNAGCLLRAVLFDPGP
NRRGRLLLVIHHLAADGVSWRVLLEDLETALRQLARGEPVALPAKTTSFQAWARRLEVHA
ASGVLAEEGAYWRDVLSADVAALPRDVPGGVNSQGSERVVTVALDADVTHSLLRASATMS
QPGLEDVLLTGVASALARWSGERRLRIDLEGHGRDELFDDVDLSRTVGWFTALFPVRLEL
PEGLASASVLASVRAAREHRKGRGVGYGLLRYLRHDAGASSEVLFNYLGQLDSGTRDSAL
FSLAPESTGASQGTRGLRSHVLEVVARVVGGRLELAWHYSEALHSRARIEALARHCVETL
VELAGATEECHALSPLQHGLLFQVLLEPGTGAYFEQRSWTLAGPLNAGALRRAWEAVSER
HSSLRTSFLWDGLEAPVQVVHARATPVWAELDWRGRSSEEQSQSLAAFLREDRAQGFVLS
QAPLMRLALIRLEDHAWRFVWSFHHLLLDGWSLARVLGEVLDAYAAIAAGADWLPPAASM
DFRTYVEWLGRRRPEQDEAFWREQLEGIEAPTPLPAAGGSTAAHDTGEHALDLGEADTAA
LQEFARSHGLTPSTLVHGAWALLLSRYGGGQDVMFATTLAGRPPELPGIEEAVGLFIHSL
PVRARIQHGAGLLPWLSELQSLLVELGQREHVPLTRLQGWSDIPRGTPLFESLLVFENYP
VDAALVRGASGLELRDFAAFERTHYPLTAVVVPGRSMRLKLLYRQERISKVAAEQLLTHW
RGLLQAMWSRPEQRLGDVSLLSEAERRRVLVEWNATATTYPREATVHSLFESQAARAPET
VAVRYGGTSLTYAELNAWANQVARRLGALGVRRGTHVGLCVERSAELVVGMLGILKAGAA
YVPLDPAYPRERLAWMIADAGAPVLLTQERLRGAVPSEGVSVLTVEEVSAQGDVAETAAL
GAGVGAADAAYVIYTSGSTGTPKGVCVSHQAVVRLVVETDFIRVVPEDRVAQASNASFDA
ATFEIWGALLNGARVVGVERETALSPSAFASWLREEGIRVLFLTTAWFNQVAAEVPDAFS
GLRQLHFGGEAVDPRPVRRVLREGAPERLLHVYGPTENTTFSTWHLVTDVPEGAVSIPIG
RPLANTVQYVLDEDMAPVPPGGVGELWLGGDGLAWGYLGQPALTAERFVPNPFSERPGTR
LFRTGDRVRLLADGAVTFEGRVDAQVKVRGFRVEPGEVEAALLRHPDVRQAVVLAREDEA
GGSRRLVAYVVPTAEAAATPEPSLLRTFLAAHLPAYMVPAAFMVLGRLPLTPNGKVDRRA
LPAPTVESEVIAPRGPEEELLAQLFGELLGVSRVGASDSFFDLGGHSLLATRVVTRIHAT
FGVALSLRELFDDPTVARLAGRIREARQSSGTARPPPIVPVSRDNPLPLSAMQERLWLLE
QLQPGTALYNVPWAAWLAGPLDVPALERALAGLFLRHEALRTTFSSNAGEPVQIIHPSAN
VALLVVDLEGLPEEAREAQAVIAASEEARRPFDLVNGPLCRALLIRTADDSHLLVLTLHH
IVSDGWSLGVAVRELSALYAAELQGRPSSLPVPTIQPADHAVWQRQWMQGEALAAQVGYW
RRQLAGAPPVLELPKDFPRPSLQRFRGDTLAVRFPAELSEAFRALCIREGVTPFMGLLAA
FQLLLSRVSGQEDVCVGSPIAGRQQPGLENLIGFFVNTLVLRARLPRSSSFRELLRQVRE
TTLDAYAHQDVPFEKLVEALQPPRSLSHAPLVQVVLALHEASRQDVAPQGLALRPVELAS
GTAKFDLTLSLTDAAEGFTGTLEFDADLFTRETAARLMKGLRVLLESAVADAGQRLGELP
MMDSADRQRLLVAWNDTAVEYPREACLAELFEAQAARSPEAVAVVCEEARLTYAELDRRA
NQLAWYLRNRGVGPGTPVGLCVQRSLDLVVGMLGILKAGGAYVPLDPTYPRERLAFMVED
TRLPVVLAQQSVVALLPSGSADVVLLDSAWDEIAREPTVSPRVTVPAESLAYVMYTSGST
GRPKGVCVPQRAVARLVLGSRFARWGADEVFLQLAPICFDAATFEVWGALLHGAKLVLFP
AQPPTVDTLKDVLARHGVTTLWLTAALFEALSAARPDALDGVRQLLAGGDVLPPAAVRER
LGRGGILVNGYGPTEGTTFTCCHVMEGAVAPGAIPIGRPIANTRVYVVDAALRPVPVGVP
GELLIGGDGLAWGYQGRPELTAERFVPNPFGSEAGGRLYRTGDSVRYREDGTLEFLERLD
GQVKVRGYRVEPGEVEEALRLHPSVAEAVVVARPDPAGGKRLVAYAVPRAGETLDPRGLR
GFLAESLPEFMVPSTLVPLMALPLTPVGKLDRRALPEPEVSRPAGSAFVEPTTALERQVA
ALWAKVLGVERVGVEDHFFADLGGSSMSVVKACALLRDELKRDVPATRFFEHPTVRAFVM
SLERDGETAADTQDNEAHVDRAQQRRQAIRRQGRRGNHGNG
NT seq 17226 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgttcccccccagcgaaggtctccggcttttccacagctccaccccttggaa
cctctcaccatgcgctcccacccggccgcgacactgctggagctcctcgaaacgcagacc
cagtccctgggtgaacggcggctgtacaccttcctggaggatggcggggatgacgcggtc
ctgagctacgccgggttggatttgcgagcccggcgcattggcgcggcactccaggccctg
gcgcgagcgggcgagcgggcggtgctcctctatccaccgggcctagagtacgtcgcgggt
ttcttcggctgtttgtatgccgggttggtcgccgtcccagcctatccgccggacccgatg
cggctggagaggacgttgcctcggctgcgcgccatcattcgggatgcgcgcgcgagcgtc
gtgctcaccacctccttcatccaggagatgggggaggggctcttcgaaggcgcccccgag
ctcgccgcgctccgctgggtggccaccgacgcgttgcccgaggggactgaggcggggtgg
cgccgtccggagccttcgcgggacacgttggccttccttcaatacacgtccggctccacg
ggggatccgaagggcgtgcagctcagccatgggaacctgctgcacaacctggggctgatc
tcccacgcgttccaggtccgctcggacagcgtgggcgtcatctggctgccgccgtaccat
gacatgggcctgattggcggcatcctccagccgctctacgcgggcttcccggtggcgctg
atgtcgccgctcgcgttccttcgccgcccacggttctggttggagtcactgtcccgcttc
ggtggcaccatcagcggcggcccgtgcttcgccttcgacctgtgcgtgaggaaggtgcct
cccgcggagcgtgaagggttggacctgcgtcgctgggagctggccttctgtggggccgag
cccatccgcccggaagtcatgacccgcttctcggaagccttcgcgcccgtgggcttccag
cgcgaggcgctctatccctgctatgggctcgcggaaggcacgctgatcgcctcgggtggg
cgcaagggcgaaggtgtcctcacgcggatgtgggacgcccaggcgttggagcggaacgag
gcgctggcggccgaggacggccctggggcgcgcccgctggtggggtgcggccagacgctg
cctgagcagacgctgctcgtcgtggacccggagacgcgtcgcgcttgcccgcccgagcgg
gtgggggagatctgggtctctggtcccagcgtggcccacggctactgggagcggcccgag
gagagcgaggccgcgttcggggcacgattggcggattcggacagcggcccccggttcctg
cggacgggagacctgggcctgctgaaggacggcgagctgttcgtcgtgggtcggcgcaag
gacctcatcatcctccgcggccgcaacctgcatccgcaggacctggagctgacgctggag
cgcagccattcggcgctgcggcccggttgtggcgcggcgttctccatcgacgtgggcggc
gaggagcggctcgcggtgatgtacgaggtggactcgcgcaagccgtggaccgccgaggac
gtggtgggcgcagtccgccggggtctggcggagacgcacgaggtccagctccacacgctc
gtcctcatcgagccaggcgcgctgccgaagacgtccagcgggaagattcagcggcgtgct
tgccgggctgaattgctcgcggggacggctcgggcgctgctgacctggagcgagtcggaa
gcagacgcgccccaggccaaggctcccgcgcctgacatcaccgcgtcccagccgctcacc
gtggaggcacttgaggcgtggttgctggcgcggatcgcctcgcggcttcgcgtccgtccg
gaggagctggcgacggatgcgcccatcacttcctttggtctggactcactgggcgccgtg
gagttggcgaacgacgtcgagaccctgggcgtggtccttcgcatggaggtccttcttcag
gggccgacggtgggggcgctcgcgctgaccctcttcgcggcgcgtggggcgtccactggc
gccgagctgacgcggggcgaggagaggacgcccgcgccgctctcctccgcgcagcaaaga
ctgtggctgttcgagcaattggcgcagggaagcgccgcgtatcacctgccggcggcggta
cggctcaccggtgcactggatgatgtggcgctggagcatgccttcgctgcaatcgttcag
cgccacgcggcactccgggcgacgttccgcgacgaagatggcacgccgtcgcaggtgacc
tcgtcggtgccggtgtcatcacttcgccgggtggacctccgcgacgtcccggtggatgcc
cgcgaggaggccgcgcttcgtctggcccacgaggaagcgcgggcgccgttcgacctcgag
cgcggtccgctgctccgggccacgctgtttcaattggacgcgcacgagcacctgctggtc
gtggtgatgcaccacatcgcctcggatggtgcctcgttcgccatcctggcccgtgagctg
agcgcgctgtacgcgggtgatgtttcgctgccgccgttggcctttcagtacccagacttc
gcgcgctggcgccgcgaggtcgaggcggacggcgccctggccacgtcgctcgactggtgg
aaggcgcggctggcagggggggccgcggcgctggaactgcccgcggatcggtctcgaccg
cccatgccatcctatcgcggtggccgcgtggcggtgcggttcccggaggcgctgacggct
cggctggaggcgttgggccggagcgaaggcgccacgttgttcatgacgttgctggcggct
ttcgaggtgctgctcgcgcgtcattcggggcaggcggacttctgcgtcggaacggccgtc
aatgggcgtgagcgggcgggactcgaagggttgatggggtgctttctcgacctgatcgtc
ctgcgcgcgtccgtgtctggctcatcacgtttccgcgaactgttgggacagacgcgggaa
ggcgtgctggcggcctttgcccaccggggcgtttctttcgagcggctggtcgacgcggtc
caacccacgagggacccctcgcgcgcacccttgttccaggtgctgttcgtgctccagccg
gagcccggcgcgggactggcgctgcccggcctggagtctcgccgcgtggaggtggacccg
ggggccacgccctacgatttgacgctgtcgctggcccgagggccggagggactgggaggg
tggctcgagtacgccacggacctgtttgatgcggacaccgccgcgcgactggtggcgcgg
ctgggcgtgcttctggaatccattgtcgcggaccctgaccagcgcctcgccatgctgccg
ctgttgcctgaggcagagcagcggcaggtgctggtcgactggaatgacacgcgggcggag
ttcccggaggcgtgcatccatgcgctcgtggagttgcaggcgcagcgcactccggacgcc
gttgccgtggtgtgtggcgacggggtcctcacgtaccgtgagctgaaccaacgagccaac
gccgtggcatggaggctgcgcgagcagggcgttggacctgagtgcatcgtgggcctcttc
gccgaccgctccgcggacctggtcgtgggcctgctgggcatcttcaaggcgggcggtgcg
tacctgccgctggacccgtcgtatcccgaggctcggctcgcgctgatgctggaggactct
ggcgcctcggtggtgctcgcgcaccggcatctggcgggcgcgcttccgttcggcgatagg
accgtggttccgctggatgtggctggcgaggccgacgccgcgccaccgggagccgtgggg
cccgacaacctggcctatgtcctctacacctcgggctccaccggcaagcccaagggcgtg
ctgattccacaccgcaacgtcgtcagcttcttcacgggcatggacgcgcgcgtggggacc
gaaccggggacgtggctcgcggtgacgagtgtctccttcgacatctccgtgttggagttg
ctctggacgctggctcgcggcttcaaggtcgccgtgcagggcgagcagggggccttgggg
gccgcgccgcgccgggtgacccgatcgcgccagaagcctctgggcttcagcctcttctac
ttcgcggcggacgagggtgctccaggcgcggagcgttaccggctgttgctggaaggtgcg
cggttcgcggaccgtcatggcttccaggcggtgtggacgccggagcgccaccttcatgcg
tttggtgggctctatcccaatccatccgtgacgagcgcggccatcgccgccatcaccgag
cgcgtagccatccgcgccggcagcgtcgtgctgcctctgcaccaccccgtgcgcgtggcc
gaggagtggtcgctcgtcgacaacctgtcgaagggccgcgtcggcatctccgttgcgccg
ggctggcacgcggatgacttcgtcctcgcgccagagcggtatgcggagcgccgggagctt
gcgcggcgggacctggacacgttgcggcggctttggcgcggtgagtcgctgtcgttcccc
aatggcgcggggacgcccatcgatgtccgcatccgtccgagccccgtgcagcgcgagctc
cctgtgtggctgaccgccgctggcaatccggacaccttccgcgaagcgggccggctgggc
gcgggcgtcctgacgcacctcttgggacagcggtgggaggagctggaatcacgcatcgcg
ctctaccgcgaggcctggcgcgaggcgggccacgagggcgagggccacgtgacgctgatg
ctccacacgttcgtggggcacgacgtggagcgcgtgcgtgagacagtcgaagcgccgctg
cggcgctacctgagcaactccgcggacctgatgcgcgggttgggccggacgctgggcgtg
gacctggatcccgcatcggtgcgtccggaggacctggacgcgctcgtgggacgggccttc
gggcgcttcttcgacggggcggggctcttcgggacgccgcgcacctgtcgggagcaggtg
gcgcgcatcgaggcgctgggcgtggatgaggtcgcgtgcctcatcgacttcggcgtggac
acggatgccgtgctcgccagccttccggcgctggacgccgtgcggcagcgctgcgagcgg
gacttccggcttcagtcgcaggaggaaatcaccgtgcccgcgcagcttcgccggcacggc
gtcacgcatctgcaatgcacgccctccctggcccaggcgctgctcttggagcccggtgcg
gccggggcgctcgtggggctggagcgcctgctcgtcggcggtgaggcgctatccgcggag
ctggcggaacggctgcggggcaccatgggcggagcgctgctcaacatgtacggccccacg
gagaccaccatctggtcttcgtcgcacgccgtggatggttcgccgggaccggtgcccatt
ggtacgcccatcgccaacacgtcgttgtacgtgctggatgcggagctgcggcccttgccc
gtgggtgtgcccggtgagctctacattggtggcatgggtgtcgctcggggctatcacgcg
cggccggagctgaccgccgagcgattcctcccggacccggcgtcctccaacgctggtgcc
cggatgtaccgaacgggcgaccgggctcgatggcgagcggatggaacggtggagttcctg
ggccgcgtggaccaccagctcaaggtccgtggcttccgggtggagcctggtgaaatcgag
tccgtgctggcgcggcactccgacgtggcgcaggccgtggtcgtggcgcgggaggcgtct
gctggaggcgctcgcctcgtcgcgtacgtcgtcgccaggccgggcacggcgctttcggtg
gaggcgctgctggccttctcccggcgctccctgccggagcacatggtgccttcggcgttc
gtgccactcgatgcgctcccgctgacgcccaacgggaaggtggaccggaaggcgttgcct
gcgccggagggtgtccgtgacgtcgctcgggagtacgtggcgcctcggacggacactgaa
cgccgtttggccgagctgtgggcttcgctgctgggcgtggagcgggtaggcgcggaggac
gacttcttcgcgctgggcgggcactcgctgctggccacgcgcgccgcctcccggattcgt
gaggcgttcggggtggacctgcccctgcgtgagttgttcgagtcgtcctcgcccgcggcc
ttgggggcgcgcatcgatgctcgcctcctgggggcgtccggggtgcctccattggtggcc
cggtctcacgaaggcgcgctgccgctgtccttcgcgcagcaacggctctggttcctggag
cagctcgagcccggtggcgccgcgtacaacgatgcggtggctgtccgtgtggagggggcg
ctcgatgtggcgttgctggagcgctctctgagagaggtggtccggcggcacgaagtcctc
cgcgccaccttccacgatgacggcggcacgccttcctggcgcatccatcccgaggcccgg
cttgctctggaccgggtggacctgaccgcgctgtctggggctgatcaggcggaggcccta
tcgttgcgattggcggaggagtcgctgcgggcgttcgacctcggcgcgggaccgccgctt
cgagccacgctgctccaggtgagcgcgcgtgagcacgtgctcttgttggtgctgcaccac
ctggtgacggatggcgcatccatgggtgtgctcgtgctcgaggtggcggcgctctatcgg
gccttctcccaggggcaggtttcgccgttgtcgccgctgccgctccagtacgtggactat
gcggcgtggcagcgcgactggcttcgcggcgaggcgctggaggcgcaactcgcgtactgg
cggacccggttgggaggggcacctcgggcgctggacctgcccacggaccggcctcgaccg
gccgtgcgcagcagccgtggcgtgagccgaagcatgctcctgggcccggagttgtcgcat
gcgctgaaaacgttggcccagcgtgagggcgccacgcccttcatggtgctgctggcgggc
ttctccgcgctgctgtcccgtcatggcgggcaggatgacctgtgcgtgggaacgccggtg
gagggccgtgaccggaccgagctggaagggctcatcggctgcttcgtcaacacgctggtc
ctgcgcgtgtcactggcgggcacgccgtccttcagggagttgattggccgcgcgcgggag
actgtgctgggggcattcgcgcaccaggacgcacccttcgaggaactggtgaaggcgctc
cagcccgagcgcgacctgggccgcagcccgctgttccaggccatgctcgtgatgcaggag
gacccgctgccggagttggtgattccggggctgcggctgaacgtccagccgcagccgagt
ctcacggcgaagttcgacctgcgactcatcatcacggacacggcggacggcttctccgcg
aacctggagctgagcaccgacctgttcgagccggataccgcaacgcgcctgctggagcac
ctgcgcgtcctgttggaggcgggcgtccgtgagccggaacagcaggtgcacgcgcttccc
ctgatgacctcggcggagcggcaccgggtcctggtggcgtggaatgacacggaccgccct
cggccaggagtgagcgtcctgcatcggctcatcgaagcgcgggtggaccgcacaccggat
gtggtggcgctgagcttcgagagcgacaccctcacgtatcgggagctggaccggcgcgcg
aatcagctcgcgcgctacctgcgggcccgaggcgtggggccggacacgcgggttgcgctg
tgcgtggagcgttcgctggagatggtggtggggctcctcggcgtgctcaaggcggggggc
gcctacgtgccgctcgacccggagtatccccgcgagcgactggagtacatgctcgcggat
gcggcggcgccggtgctgctgacgcaggctcggttgtcggaacgcctgcctcgggacagc
gccaccgtggtgtgtctggactcggagtgggacgcggtggcgcgcgagcgcgaggagcgt
ctcgacgtgaccgtggatgggagcgggctggcgtacgtcctctacacctcgggctccacg
ggccggcccaagggggcgatgaacacgcatgccgccatctgcaatcggctcctgtggatg
caggaggcctacgggcttgattcgagcgaccgcgtcctccagaagacgccgttcagcttc
gacgtctccgtgtgggagttcttctggccgctgctggcgggcgcgcggttggtgatggcg
cggcctggcgggcaccgggagcccgcgtatctgacggacaccatcgctcgcgagcgcatc
accacgttgcacttcgtgccgtccatgctccggcccttcctggaggagacggagctggca
gtgtcctgcgccagcctgagaagggtgttctgcagtggcgaggcgctgcctcccgagctg
agggatcgctacttctcgtgcctgctcgccgagcttcacaacctctacggcccgacggag
gccgcggtggacgtgacggcgtgggcctgcgcacgtgaggaccgtgggcatgtcgtgccc
atcgggcgccccatcgccaacgcgcggatgtacgtgctggatgcgcggctgcgtcccgtg
ccagcgggtgtgccgggtgagctgtacatcgggggtgcaccgctggcgcgcggctactgg
cagcggccggacctgaccgctgagcgattccttccggacgccttcgcggcgcagccgggg
gcgcggatgtaccggacgggcgatcaggcccgcttcctggcgaatggcgccatcgagtac
ctgggccgcctggatgaccaggtgaagctgcggggcttccgcatcgaattgggagagatt
gaagccgtgctgtccctgcaccccggcgtgcgtgcggcggcggtggcgattcgagaggac
gtcccgggagaccggcgcctcgtggcgtacgtggtcgcgccttcgggggacgtggcatcg
gagcttcgggccttcctcggtgagcgactgcccgagcacatggtgccgtcggccttcgtc
acgctggacgcgctcccgctgtcgcccagtgggaagctcgaccgtcgtggcctccccgca
ccggtgcgggcagtgcaggggcgtggtgcggcccacgtcgagccgcgtaacgcgctggaa
cttgagatcgcgcagatctgggcgggcgttctgggcgtcgagcgggtaggcgccgaggac
cgcttcttcgagctgggcggtgactccatcctcgcgcttcaggtgattgcgcgggcgcgg
caggtgggcatccacctcaccgcgcgccagctcttccagcatccgacggtggcagggctg
gcacaggtggcgacgagccgtcgtcgcttgggagaccagggcccggttgtagggcccgtg
ccgctgacgcccatccagcgctggttcgtcgagcgcgagcttcccgaagcgcatcacttc
aaccaggcgttgatgctggagccccgtgagcgcctggagtcggacgtgctggcctgcgca
ctgcgggccctcgtggaccatcacgatgcgctgcggctgcggctgtcgcggagtgatacg
gggtgggcgcagtcgtgcgcagagccagggcgcgacgtgccactgcgtctcgtggaccta
tccgggttggatgccgccgcgcgggccgtggcgatggagcgcaccgccacggaggagcag
gcgggtttggacctgaatgcggggtgcctcctgcgcgccgtgttgttcgacccgggacca
aatcggaggggacggctgctgctggtcatccaccacctcgcggcggacggcgtctcctgg
cgcgtgttgttggaggacctggagacggcgcttcggcagcttgcccgcggagagccggtg
gcgcttcccgcgaagacgacgtcgttccaggcctgggcacgacggttggaggtgcatgcc
gcctcgggggtgctcgcggaggagggggcctactggcgggacgtgctgagcgcggatgtg
gccgcgcttcctcgggatgtgccgggtggggtgaactcgcagggctcggagcgcgtcgtc
acagtggcactggatgccgacgtgacgcactcgctgcttcgtgcatcggcgacgatgtca
cagccgggccttgaagacgtgctcctcacgggtgttgcgagcgcgctggcccgatggagt
ggcgagcgccgactgcgcatcgacctggagggccacgggcgcgacgagctgttcgacgac
gtggacctctcacgcacggtagggtggttcaccgcgttgttccccgtgcgtctggagttg
ccggaggggttggcgtccgcttccgtgctcgcgtcggttcgcgcggcacgcgagcatcgg
aagggcagaggtgttggatatggcctgctgcgctaccttcgccatgatgccggcgcttcg
tctgaggtcctcttcaactacctcgggcagctcgactcgggtactcgggactcggcgctg
ttctcgctggcgcccgaatccacgggggcctcgcaggggacgcgtgggctccggagccat
gtgttggaggtggtggctcgcgtcgtgggcggacgcctggagttggcctggcattacagc
gaggcgctgcattcgcgcgcgcgcatcgaagccctggcgcgtcactgtgtcgaaacgttg
gtggaactcgcgggcgcgacggaggagtgtcatgcgctctctcccctccagcatgggttg
ttgttccaggtgctgctggagcccggcaccggcgcgtacttcgagcagcgaagctggacg
ctcgccggtccgctgaacgccggagcactccggcgggcatgggaggcggtgtccgaacgg
cattcctcactgcgcacctcgttcctctgggacgggttggaggcccctgtccaggtggtc
catgcacgcgcgacccctgtgtgggctgagctcgactggcgcgggcgctcctcggaggaa
caatcccagtcactggccgcgttcctgcgtgaggaccgggcacagggctttgtcctgtcg
caggcgccgctgatgcggctggcgctgattcgactggaggaccatgcctggcggttcgtc
tggagcttccatcacctgcttctcgatgggtggagtctggcgcgcgtccttggcgaggtg
cttgatgcttacgcggcgattgccgcaggggcagattggctcccgcccgccgcctcaatg
gatttccgcacctacgtggaatggctggggcgccgccgacctgagcaggacgaagccttc
tggcgggagcagctcgagggcatcgaagcgccgacgccattgcctgcggcaggaggctcc
accgcggcgcatgacacgggtgagcacgcgctggatttgggcgaggccgataccgctgcg
ctccaggagttcgcacgcagccatgggctcacgccgagcaccctggtccacggtgcgtgg
gcgttgctgttgtcccgctatgggggcgggcaggacgtcatgttcgcgacgacgctcgcg
ggccgtccgccggagctaccgggcatcgaggaagccgtcgggttgttcatccactcgctc
ccggttcgcgcccgtatccagcatggcgccgggttgctgccctggctgagcgagcttcag
tccctgctggtggagttggggcaacgggagcacgtcccgctcacccggcttcaggggtgg
agcgacattccccgaggcacgccgctcttcgagagtctcctcgttttcgagaactacccg
gtggatgccgcgctcgtacgcggtgcgtccgggttggagctgcgggacttcgcggccttc
gagcgcacgcactatccgctgaccgcggtggtggttccgggacgctccatgcggctgaag
ctgctgtaccggcaggagcgaatctcaaaggtcgctgccgagcagttgctgacgcactgg
cgcggtctgcttcaggcgatgtggagtcgtcctgagcagcgactgggcgacgtgtccctg
ctgtcggaggccgagcggcgccgcgtgctggtggagtggaacgccaccgcgaccacgtac
ccccgcgaagccacggtgcattcgctgttcgagtcccaggccgcgcgggcgccagagacc
gtggcggtgcggtatggcggaacgtcgctgacgtacgccgagctgaacgcgtgggcgaac
caggtggcgcgccggctgggggccttgggagtccgacgagggactcacgtgggcctctgc
gtggagcgctccgccgagctggtcgttgggatgctgggcatcctcaaggcgggggcggcc
tacgtgcccctggatccggcgtacccgcgcgagcggctcgcatggatgatcgcggatgcg
ggggcacccgtactgctgacgcaggagcggctgcggggggcggtgccttcggagggcgtg
agtgtcctcacggtggaggaggtctcggcgcaaggggacgtcgctgaaacggcggcgctt
ggagccggagtcggcgcagcggatgccgcctacgtcatctacacctccggctccacgggg
actcccaagggcgtctgcgtttcccatcaggccgtggtccggctggtggtggagacggac
ttcatccgcgtggtgcctgaggatcgcgtggcgcaggcatccaacgcctcgttcgacgcg
gccacgttcgaaatctggggtgcgctcctcaacggtgcccgagtggttggcgtggagcgg
gagacagcgctctctccgagtgccttcgcgtcctggctgcgggaggagggcattcgcgtc
ctcttcctcacgacggcctggttcaaccaggtggccgcggaagtgccggacgccttcagc
gggttgcgacagctccacttcggaggagaggccgtggacccgaggccggtccgccgggtc
cttcgtgaaggtgctcccgagcggctgctgcacgtctatggccccacggagaacaccacc
ttctccacgtggcacctcgtcacggatgtgcccgagggcgccgtatcgattcccatcggg
aggccgctggcgaacacggttcagtacgtgctcgacgaggacatggcgccggtgccgcca
ggaggcgtgggggagctgtggcttggtggcgacggactcgcctggggctatctgggacaa
cccgcgctgacggcggagcgcttcgttccgaacccgttcagcgagcgtcccgggacgcgg
ctcttccggacaggtgaccgggtccgtctgttggcggatggggcggtgacctttgagggc
cgcgtggacgcacaggtgaaggtgcgaggcttccgcgtggagccgggcgaggtcgaggcc
gcgctgctgcgtcacccggacgtccggcaagccgtggtgttggcgcgagaggatgaagca
gggggctcgcggcgtctggtggcctacgtcgtaccgaccgcggaggccgccgcgactccc
gagccttcgctcctgcggaccttcctcgccgcgcacttgccggcgtacatggtgcctgcc
gccttcatggtactggggcgcctgcccctgacgcccaacggcaaggtggaccggcgtgcg
ctgcccgcgcccaccgtcgaatcggaggtcatcgcaccgagaggccccgaggaggaattg
ctcgcgcaactctttggcgaactgcttggtgtctcccgggttggagcgtccgacagcttc
ttcgatttgggtggacactccctgctggccactcgggtcgtcacgcggattcacgccacc
tttggcgtcgccttgtcgctgcgggagctcttcgacgacccgaccgtggcgaggctggcc
gggcgcatccgcgaggcccggcagtcctctggcacggcgcgcccgccgcccatcgtcccc
gtgtccagggacaaccccttgccactgtccgcgatgcaggagcgcttgtggttgctggag
cagctccagccaggcacggccctctacaacgtcccctgggctgcatggctcgccggtccg
ctggacgtgcctgccttggagcgggcactggcggggctgttcctgcggcacgaagccctg
aggaccaccttctccagcaacgcgggagagcccgtccaaatcatccatccgagcgccaac
gtggcgcttctcgtggtcgacctcgaggggcttccggaggaggcgcgtgaagcacaggcc
gtgatcgccgcgtcggaagaggctcgccgcccgttcgacctggtgaatggaccgctgtgc
cgggcattgctgattcgaacggctgatgattcgcacctgctggtcctcacgctgcaccac
attgtctcggacgggtggtcactgggcgtcgccgtgcgggagctgtcggcgctctacgcc
gcggagctgcagggccggccttcctcgctgccagtgcccaccatccagccagcggaccat
gcggtgtggcagcgccagtggatgcagggagaggcactcgcggcgcaggtcggatactgg
agaaggcagctcgccggagcgccgcccgtcctggagcttcccaaggacttcccccggccg
agcttgcagcgcttccggggtgacacgctggcggtgcgtttccccgccgagctgtcggag
gcgttccgtgcgctctgcattcgtgaaggcgtcacgcccttcatgggcctgctggcggcc
ttccagctcctgctgtcgcgggtgtctggccaggaggacgtgtgtgtgggatcgcccatc
gcgggccggcagcagcctgggctggagaacctgattggcttcttcgtcaacacgctggtg
ctccgcgcgcgtctgccgcgctcgagctccttccgtgagctcctgcggcaggtgcgggag
acgacgttggacgcgtacgcccaccaggacgttccgttcgagaagctggtcgaggcgctg
caaccacctcggagcttgagccacgcgcccctggtgcaggtggtgctcgcgcttcacgaa
gcctcgcgccaggacgtcgcgccgcaagggctggctctccgcccagtggaactggcctcg
gggacagcgaagttcgacctcacgttgtccctgacggacgcggcagaagggttcaccgga
accttggagttcgacgcggacctcttcacgcgggagacggccgcgcggctgatgaagggg
ctccgggtgttgctggagagcgcggtggcggatgcgggccaacgcctgggcgagctgccg
atgatggactcggcggatcgtcaacgcctgctcgtggcgtggaacgacaccgcggtggag
tacccccgagaggcatgcctcgcggagctcttcgaggcgcaggcggcgcgctcgccggag
gcagtcgcagtggtgtgcgaggaggctcggctcacctacgcggagctggaccggcgggcg
aaccagcttgcgtggtacctgcgcaatcgtggcgtgggaccggggacaccggtggggctg
tgcgtgcaacgttcgctcgacctggtggtggggatgctcggcatcctcaaggccggtggc
gcctacgtgccgttggaccccacgtacccccgcgagcgcctggccttcatggtggaggac
acgcgcctgcccgtggtgctggcgcagcaatcggtggtggctttgctgccttcgggcagt
gcggacgtggtgctcctggattcggcctgggatgaaatcgcgcgtgagcccacggtttcg
cctcgcgtgacggtgccggcggagtcgctggcgtatgtcatgtacacgtcgggctccacg
gggcggcccaagggcgtctgcgtgccgcagcgcgcggtggctcggctggtgctgggctcc
cgattcgcgcgttggggcgcggacgaggtcttcctccaactggcgcccatctgcttcgac
gccgccaccttcgaggtgtggggcgcgctgctgcacggcgcgaagctggtcctcttccca
gcgcagcctcccacggtggacacactcaaggacgtgctggcacgtcacggtgtcaccacg
ttgtggctcacggccgcgctcttcgaggcgctctccgccgcgaggccggacgccctggat
ggcgtgcggcagctcctggcgggcggcgacgtgctcccaccggcagcggtgcgggagcgg
cttggacgcggcggcatcctggtcaacgggtatgggcccaccgagggcaccaccttcacc
tgctgccatgtgatggagggcgccgtcgcgccgggggccattcccattggccggcccatc
gccaatacgcgggtgtatgtggtggacgcggcgttgcgccccgtgccggtgggcgtaccg
ggtgagctgctcattggtggagacggcctggcctggggttatcagggtcggccggagctg
acggcggagcgcttcgttccgaaccccttcggctcggaggcgggcgggcggctgtaccgg
acgggcgacagcgtgcgctaccgcgaggacggcacgctggagttcctcgagcggctggac
ggtcaggtgaaggtgcgtggctaccgggtggagccaggcgaggtggaggaggcgttgcgc
ctgcacccgtcggtggccgaggcggtggtggtggcgcggcccgaccccgcgggaggcaag
cggctggtggcctacgcggtgcctcgggcaggggagacgttggacccccgcggccttcgc
ggcttcctggcggagtcgctgcccgagttcatggtgccttccacgctggtcccgctgatg
gcgctgccgctcacgcccgtgggcaagctggaccggcgcgcgctgccggagccggaggtc
tcgcgtccagcagggagtgccttcgtggagcccaccaccgcgctggagcgtcaggtggcg
gcgctctgggcgaaggtgctcggcgtggagcgggtcggtgtggaagaccacttcttcgcg
gacctgggcggcagctccatgtccgtggtcaaggcgtgcgcattgctgcgcgacgagctg
aagcgagacgttccggcgacgcgcttctttgaacatcccacggtccgcgcgtttgtcatg
tccctggagcgggacggcgagacggcggcagacacccaggacaatgaggcccacgtggat
cgcgcccagcagcggcgtcaggcgatccgccggcagggtcggcgagggaatcacggcaat
ggctga

DBGET integrated database retrieval system