KEGG   Myxococcus xanthus: MXAN_4571Help
Entry
MXAN_4571         CDS       T00366                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00620  Pyruvate metabolism
mxa00680  Methane metabolism
mxa01100  Metabolic pathways
mxa01120  Microbial metabolism in diverse environments
mxa01200  Carbon metabolism
Module
mxa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MXAN_4571 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    MXAN_4571 (ppc)
Enzymes [BR:mxa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MXAN_4571 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GBP_repeat
Motif
Other DBs
NCBI-ProteinID: ABF88461
UniProt: Q1D3N4
LinkDB All DBs
Position
complement(5703279..5705948)
Genome map
AA seq 889 aa AA seqDB search
MARLRAVDQPLRRDVRLLGRLLGEVLVEQEGQALFDLEEEVRRLAIQRRRGPVAGRRAVA
AELAEVLQRLPLERAEPVLRAFSVYFQLVNLAEQHHRIRRARTHAEVASAKPQRGSLEAT
LQVLKEAGIPAERVREAMRTMRVTLTLTAHPTQAVRRTLLEKLYRMAGLLEERDRCELTP
RESSVNLALLREEITLLWQTDELRRERPTVGDEVKNVLWYVEEVLADELSLLPELLDWAF
ERAYGEPLGPVDTPVRIHSWVGGDMDGNPLVTPDVFADTLRAHRARGLRRLLLDLERLGG
RLSQSARHAKPSEELLSSVAKDAEELPDTERRYGPRTPGEPLRHKLRFMEERLHRALHYV
TQQRAGTSVPMPQGAYRTPEALLADLDVLGRALEASKGTHAGLRDVRQVRERVLALGLSL
AELEVRAPAEDAVSAAGSFNGGPAPTEGGARLLEVLARLKEAQSESGESACRTLILSMAS
TAEDVLAAFRCLKHAGLWDEKRGCATANVVPLFEQLGALDSGPDVLRTLFADAEYRKHLD
VRGGQEVMVGYSDSGKEVGLLAASAALYRAQVALTEVSREAGVPLRLFHGRGESVARGGG
PAQEAILALPPGAVAGGYKATEQGEALDHKYARPELARRTVELILGGVLLHTLDAQPRPE
PEAERTFRTVFDTLAETGRKAYRALVWEDPRFLEFFTAATPVEEIASLPIGSRPSKRRAG
GLDTLRAIPWVFAWTQNRAILPGWYGVGSALEAFSKEEGGAAQLKRMYQEWPFFRAVIDN
VTMVLAKSDMAIAGRYASLAPPATRSLWRRIQQEHRRTRRQVKRLTGESKLLDNNPQLQR
SISLRNPYVDPMSFLQVELLKRKREGQAEVDRPLLLTLNGIAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcccgactgcgtgccgtggatcagccgctgcgccgggatgtccgcctgcttggccgg
ctcctgggagaagtcctcgtcgaacaggaagggcaggcgctcttcgacctggaagaagaa
gtgcgccgcctcgccatccagcgccgccgaggccccgtggccggccggcgcgcggtggcg
gccgagctggcggaggtgctccaacgcctgccgctggaacgggccgagccggtgctgcgc
gccttctccgtctacttccagttggtgaacctggcggagcagcaccaccgcatccgccgc
gcccgcacccacgcggaggtcgcgtccgccaagccccagcgtggttcgctggaggctacg
ctgcaagtgctcaaggaagcgggcatccccgcggagcgcgtgcgcgaggccatgcgcacc
atgcgcgtgacgctgacgctcaccgcgcaccccacgcaggccgtgcgccgcacgctgctg
gagaagctctaccgcatggcgggcctgctggaggagcgggaccgctgcgagctgacgccg
cgcgagtcctcggtgaacctggcgctgctgcgcgaggaaatcaccctcctgtggcagacg
gacgagctgcgccgcgagcgccccaccgtgggtgacgaggtgaagaacgtcctctggtac
gtggaggaggtgctcgccgacgagctgtccctgctccccgagctgctggactgggccttc
gagcgcgcctacggcgagccgctggggccggtggacacgcccgtgcgcatccactcatgg
gtgggcggggacatggatggcaacccgctggtgacgcccgacgtgttcgcggacacgctg
cgcgcgcaccgggcccgaggactgcgacggttgctgcttgacctggagcggttgggcggg
cggctgtcccagtcggcgcgtcacgcgaagccgtccgaggagctgctgagctcggtggcg
aaggacgcggaggagctgcccgacaccgagcgccgctacggtccccgtaccccgggcgag
ccgctgcggcacaagctgcgcttcatggaggagcggctgcaccgtgcgctccactacgtg
acgcagcagcgcgccgggacgagcgtccccatgccgcagggcgcctaccgcacgccggag
gccttgctggcggacctggacgtgctgggccgcgcgctggaggcgtcgaagggcacgcac
gcgggacttcgcgacgtgcggcaggtccgggagcgggtgctcgcgctgggactgtcgttg
gcggagctggaggtgcgcgcgccggccgaggacgcggtgagcgcggcgggctcgttcaac
gggggcccggcgccgacggaaggtggggcgcggctcctggaagtgctggcgcggctgaag
gaggcccagtcggagtcgggtgagtccgcgtgccgcacgctcatcctcagcatggccagc
accgccgaggacgtgctcgcggccttccgctgcttgaagcacgcgggcctgtgggacgag
aagcggggctgcgccacggcgaatgtggtgccgctgttcgagcagttgggcgcgctggac
tcgggcccggacgtgctgcgcacgctcttcgcggacgcggagtaccgcaagcacctggac
gtgcgcggtggccaggaagtgatggtgggctacagcgactccggcaaggaggtggggctc
ctggcggccagcgcggcgctgtaccgcgcgcaggtggcgctcacggaggtgtctcgtgag
gcgggcgtcccgctgcgactcttccacggccgcggcgagtccgtggcgcgtggcggtggt
cccgcgcaggaggcgattctcgcgctgccgccgggcgcggtggcgggtggctacaaggcg
acggagcagggcgaggcgctggaccacaagtacgcgcgcccggagctggcgcggcgcacg
gtggagctcatcctgggcggcgtgctgctgcacacgctggatgcgcagccgcgaccggag
cccgaggccgagcgcaccttccgcaccgtgttcgacacgctggcggagacggggcgcaag
gcgtatcgcgccctggtgtgggaggacccacggttcctggagttcttcaccgccgcgacg
ccggtggaggagattgcgtcgctgcccatcggctcgcgccccagcaagcgcagggcggga
ggcctggacacgctgcgcgcgattccgtgggtcttcgcctggacgcaaaaccgggccatc
ctcccgggctggtacggcgtgggctcggcgctggaggccttctcgaaggaggagggtggg
gcggcgcagctcaagcgcatgtaccaggagtggcccttcttccgcgccgtcatcgacaac
gtcaccatggtgctggcgaagtcggacatggccatcgccgggcgttacgcgtcgctggcg
cctcccgccacccgttcgctgtggcggcgcatccagcaggagcaccggcgcacgcgcagg
caggtgaagcggctgacgggcgagtcgaagctgctcgacaacaacccgcagctccagcgc
agcatctccctgcgcaacccctatgtggaccccatgtccttcctccaggtggagctgctc
aagcgcaagcgcgagggccaggcggaggtggatcgtccactgttgctcacgctcaacggc
atcgccgccggcatgcgcaacaccgggtag

DBGET integrated database retrieval system