KEGG   Myxococcus xanthus: MXAN_6074Help
Entry
MXAN_6074         CDS       T00366                                 

Definition
(GenBank) DNA ligase, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mxa  Myxococcus xanthus
Pathway
mxa03030  DNA replication
mxa03410  Base excision repair
mxa03420  Nucleotide excision repair
mxa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MXAN_6074
   03410 Base excision repair
    MXAN_6074
   03420 Nucleotide excision repair
    MXAN_6074
   03430 Mismatch repair
    MXAN_6074
Enzymes [BR:mxa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MXAN_6074
    6.5.1.6  DNA ligase (ATP or NAD+)
     MXAN_6074
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MXAN_6074
DNA replication proteins [BR:mxa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MXAN_6074
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MXAN_6074
DNA repair and recombination proteins [BR:mxa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MXAN_6074
   NER (nucleotide excision repair)
    Other NER factors
     MXAN_6074
   MMR (mismatch exicision repair)
    Other MMR factors
     MXAN_6074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABF88425
UniProt: Q1CZG4
LinkDB All DBs
Position
7517372..7518967
Genome map
AA seq 531 aa AA seqDB search
MRRLADLYETLDQTTSTNAKVEALARYFKEAPPEDAAWALYFLTGQKLKRLIPTKLLVGW
TQELTRIPSWLFEEVYASVGDLAEVIALLLDARERPARTEELPLSVWLEQRLLPLRQLDA
AGQREQVVSWWHAMPRRELFLLNKMLTGELRVGVSSTLVVRAVAQVAGLPAPSVAHRLMG
TWTPSPTFFRQLVSQDVSDSDSSRPYPFYLASPLEQPPGDLGDRAEWQVEWKWDGIRGQL
IHRKGSVHLWSRGEELITERFPEIADAAAALPEGTVLDGEVLAYADGRPLPFAQLQRRIG
RQKLTPKVLAEAPAAYLAYDMLELGGEDLRSQPLRVRRAKLEALLEDVPRLPVSPVVQAA
TWEDLATARGEARERNVEGFMLKRLESPYLTGRKRGDWWKWKIDPFTVDAVLLYAHPGHG
RRSSLYTDYTFAVWNGTELQPVTKAYSGLTDAEIGRLDRWIRAHTREKYGPVRSVEPEQV
FELHFEGIQSSPRHKSGVALRFPRIARWRTDKKPQDADTLDSLKELLHASG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgactggcggacctctacgaaacgctggaccagaccacgtccaccaacgccaag
gtggaagcgctcgcgcgctacttcaaggaagcgcccccggaggacgcggcgtgggcgctc
tacttcctcacggggcagaagctgaagcggctgattcccacgaagctgctggtggggtgg
acgcaggagctgacccgcatccccagttggctcttcgaggaggtctacgcctccgtgggt
gacctggcggaggtgattgccctgctgctggacgcccgtgagcgcccggcgcggaccgag
gagctgcccctgtccgtctggctggagcaacgcctgttgccgctgcgtcaactggacgcc
gccgggcaacgcgagcaggtggtttcctggtggcacgccatgccccggcgtgaattgttc
ctgctcaacaagatgctcaccggcgaactgcgggtgggcgtgtcctccacgctggtggtc
cgcgcggtggcgcaggtggcgggcctgcccgcgcccagcgtggcgcaccggctgatgggg
acgtggacgccctcgcccaccttcttccggcagctcgtgtcccaggacgtgtcggatagc
gacagctcccggccctaccccttctatctcgcgtcgccgctggagcagccaccaggggac
ctgggcgaccgggcggaatggcaggtggagtggaagtgggatggcatccggggccagctc
atccaccgcaagggcagcgtgcacctgtggagccgcggcgaggagctcatcaccgagcgc
ttccccgaaatcgcggacgccgccgccgcgctacccgagggcacggtgctggacggcgag
gtgttggcctacgcggacggaaggcccctgcccttcgcccagctccagcggcgcatcggc
cggcagaaactgacgcccaaggtgctggccgaagcgcccgcggcctacctcgcctacgac
atgctggagctgggaggcgaggacctccggagccagccgctgcgcgtgcggcgcgcgaag
ctggaggcgctgttggaagacgtgcctcggctccccgtctcccccgtcgtgcaagcggcg
acctgggaggacctggccaccgcgcggggcgaagcgcgagagcgcaacgtcgagggcttc
atgctcaagcgcctggagtcgccgtacctcacagggcgcaagcggggcgactggtggaag
tggaagattgacccgttcacggtggacgcggtgttgctgtacgcgcatccgggccacggt
cggcgctcgtcgctgtacaccgactacaccttcgcggtgtggaacggcacggagctccag
cccgtgacgaaggcgtactccggcctgacggacgcggagattggccggctggaccggtgg
attcgcgcgcacacgcgggagaagtacggccccgtgcgctcggtggaacctgaacaggtg
ttcgaactgcacttcgagggcatccagtcctcgccgcgtcacaagtcgggcgtcgcgctg
cgcttccctcgaatcgcccgctggcggacggacaagaagccgcaggacgcggacacgctg
gactcactcaaggagctgctccatgccagcgggtag

DBGET integrated database retrieval system