KEGG   Myxococcus xanthus: MXAN_6122Help
Entry
MXAN_6122         CDS       T00366                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MXAN_6122 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mxa02000]
    MXAN_6122 (gst)
Enzymes [BR:mxa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MXAN_6122 (gst)
Transporters [BR:mxa02000]
 Other Transporters
  Pores ion channels [TC:1]
   MXAN_6122 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 DUF1958 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ABF87712
UniProt: Q1CZB6
LinkDB All DBs
Position
7567840..7568448
Genome map
AA seq 202 aa AA seqDB search
MKLFYSPGACSLSPHIILREGGFSFTTEKVDIRAKKTAAGEDFHAINPKGYVPALQLDDG
SLLTEGPAIVQFLADQVPDKKLAPANGTLERYRLQEMLNFISTEIHKGFSPLFNPAFPDD
VKRLTRERLAQRLGVLEVVVAKQAFLLGDQFTVADAYLFTTLNWAGHTKVDLEPFPALRA
YHARVADRPSVQEALKAEGLAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttctactcccctggcgcctgttcgctgtcgccccacatcatcctgcgtgag
ggcggcttctccttcaccaccgagaaggtggacatccgcgccaagaagacggcggcgggc
gaggacttccacgccatcaaccccaagggctatgtcccggcgctccagttggatgacggc
agcctgctgaccgagggccccgccatcgtccagttcctcgccgaccaggtccccgacaag
aagctggccccggccaacggcacgctggagcgctaccgcctccaggagatgctcaacttc
atctccaccgagattcacaagggcttcagccccctgttcaacccggcgttcccggatgac
gtcaagcggctgacgcgtgagcggctcgcgcagcgcctgggcgtgctggaggtggtggtg
gcgaagcaggcgttcctgctgggcgaccagttcaccgtggcggacgcgtacctcttcacg
acgctcaactgggccgggcacaccaaggtggacctggagcccttccccgcgctgcgcgcc
tatcacgcccgcgtggcggaccggccctccgtgcaggaggccctgaaggcggaaggcctc
gcgaagtga

DBGET integrated database retrieval system