KEGG   Myxococcus xanthus: MXAN_6188Help
Entry
MXAN_6188         CDS       T00366                                 

Gene name
katE
Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00380  Tryptophan metabolism
mxa00630  Glyoxylate and dicarboxylate metabolism
mxa01110  Biosynthesis of secondary metabolites
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MXAN_6188 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MXAN_6188 (katE)
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MXAN_6188 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABF92681
UniProt: Q1CZ54
LinkDB All DBs
Position
7651363..7653513
Genome map
AA seq 716 aa AA seqDB search
MKLRKPSAKTRPTTLKSESLEPHRMHAVGKVLTTDQGIPISDTDNSLKAGIRGPTLLEDF
HFREKMMRFDHERIPERAVHARGAGAHGYFQVYKSLEKYTQARFLTDPSLRTPVFVRFST
VGGSRGSADTVRDVRGFATKFYTEEGNFDLVGNNMPVFFIQDGIKFPDFVHAVKPEPHNE
IPQASSAHDSLWDFVSLVPETTHMIMWLMSDRAIPRSFRMMEGFGVHTFRLVNAAGKANL
VKFHWKPLLGNHSLVWDEAQKLSGKDPDFHRRDLWESIERGDFPEYELGLQIIPEGDELK
YGFDLLDATKLLPEELAPVQRVGKLTLNRNPDNFFAETEQVAFCVANVVPGIDFTNDPLM
QARLFSYLDTQLTRLGGPNFAELPINKPVCPVTNHQQDGFGRQTIPTSRANYHPNSLGGG
CPVLANPASAFRHTQERVEGHKIRARSGSFSDHFSQATLFYKSLSRPEQEHLVAALEFEV
GKVERVEIRERVVNQILVNVDPELAVRVARAVGVTPPKATRPPKPSKAAGKKAAPSVEVS
PALSMENSPHDSIRTRKIAALVSDGFAGKELDGVRKVLEERGATLELVGPTLSPVTSQEG
REERPLRTFSTASSVMYDAVYVPGGEKSVAALLRVPLAVDFVREAYVHCKALALSADANT
LLDAAGVRDLEAPPSKGLDATRGVVRSAKVETKGFGQLFTESIARRHWEREAPPPA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgcaagccctcggcgaagacccggcccaccacgctcaagagcgaaagcctc
gaaccccaccggatgcatgcggtggggaaggtcctcaccacggaccagggcattcccatc
tcggacacggacaactcgctgaaggccggcatccgcggccccacgctcctggaggacttc
cacttccgggagaagatgatgcgcttcgaccacgagcgcatcccggagcgcgccgtccac
gcgcggggcgcgggcgcccacggttacttccaggtctacaagtcgctggagaagtacacc
caggcccgcttcctcaccgacccatccctgcgcacgccggtgttcgtgcgcttctccacc
gtgggcggctcacgtggctcggcggacaccgtgcgtgacgtgcgcggcttcgccaccaag
ttctatacggaggaaggcaacttcgacctggtgggcaacaacatgcccgtcttcttcatc
caggacggcatcaagttcccggacttcgtccacgcggtcaaacccgagccgcacaacgaa
atcccccaggcatcctcggcgcatgactcgctctgggacttcgtctcgctcgtccccgag
acgacgcacatgatcatgtggctgatgtccgaccgcgccattccgcgcagcttccggatg
atggagggcttcggcgtccacaccttccggctggtcaacgcggccggcaaggcgaacctg
gtcaagttccactggaagccgctactgggcaaccactcgctcgtgtgggacgaggcccag
aagctgtccggcaaggacccggacttccaccgccgcgacctctgggagtccatcgagcgc
ggtgacttccccgagtacgagctggggctgcaaatcatccccgaaggcgacgagctcaag
tacggcttcgacctgctggacgccaccaagctgctccccgaggagctggcgccggtgcag
cgcgtgggcaagctgacgctcaaccgcaacccggacaacttcttcgcggagacggagcag
gtggccttctgcgtggccaacgtcgtccccggcatcgacttcaccaatgacccgctgatg
caggcgcggctcttctcgtacctggacacgcagctcacgcggctgggcgggcccaacttc
gcggagctgcccatcaacaagccggtgtgccccgtcaccaaccaccagcaggacggcttc
gggcggcagaccattcccacgtcgcgcgccaactaccaccccaactccctgggcggcggc
tgcccggtgctggcgaaccccgcgagcgcctttcgccacacccaggagcgcgtggagggc
cacaagattcgcgcgcgcagcggcagcttcagcgaccacttcagccaggccaccctcttc
tacaagagcctgtcgaggccggagcaggagcacctcgtggccgcgctcgagttcgaggtt
ggcaaggtggagcgcgtggagattcgcgagcgcgtggtgaaccagattctggtgaacgtt
gacccggagctggccgtgcgcgtggcgcgcgccgtgggcgtcacgccgccgaaagcgacc
aggccccccaagccgtccaaggccgcgggcaagaaggcggcaccctcggtggaagtgtcc
ccggcgctgagcatggagaactcgccgcatgactccatccggacgcggaagatcgcggcc
ctggtatcggacgggttcgccggcaaggagctggacggcgtgcgcaaggtgctggaggag
cgcggcgcgacgctggagctggtgggccccacgctgagcccggtgacgagccaggaaggc
cgggaggagcggcccctgcggaccttctccacggcgtcttccgtcatgtacgacgccgtc
tacgtgcccggtggagagaagagcgtcgcggccctgctgcgcgtgccgctggcggtggac
ttcgtgcgcgaggcctacgtgcactgcaaggcgctggcgctctccgcggacgccaacacc
ctgctggacgccgcgggcgtgcgcgacctggaggcgccgccgagcaagggcctggacgcc
acgcgcggcgtcgtccgcagcgcgaaggtggagacgaagggcttcggccagctcttcacc
gagtccatcgcccgccgccactgggagcgtgaggccccgcccccggcgtag

DBGET integrated database retrieval system