KEGG   Myxococcus xanthus: MXAN_6636Help
Entry
MXAN_6636         CDS       T00366                                 

Definition
(GenBank) AMP-binding protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ABF92798
UniProt: Q1CXX0
LinkDB All DBs
Position
complement(8164932..8166710)
Genome map
AA seq 592 aa AA seqDB search
MKGAGSRLVGPALPPPRHLTVNAALADTGRTSPLGLTFVDAAEREVSMPWADVYRRAKRT
AAGLARLGVSEGDRVALLLPTSPAFMDAFFGTLLAGAVPVPLYPPVRLGRLDEYHRATSR
MLHVTGSVMVLTDVRVRLLLGPSVERARPRLGCHTVDEVSRGDDVLEVPVRPDALGLIQF
SSGSTVDPKPVTLTHEALLAQVAALEMAMPLGAGVPRVGVSWLPLYHDMGLIGCLLSALY
YPGSLVLIPPEAFLARPALWLRALSRHRGYISPAPNFAYGLCLKRVKDAELDGVDLSSWR
HALNGAEPVSVDTLRRFSVRFERWGFSARALRPVYGLSEASLAVTFPPEGRGPRALGVDA
GLLAREGRVAEGSRELVSVGMPVAGFEVEVRGETGEALAERCVGRVFARGPSLMAGYFAD
AQATDRTLTRDGWLDTGDLGFIAEGELFLTGRAKDVVIIRGANHAPQAFEEPLQSVAGVR
AGCAVALGFTPEGGEDEALLILAERSGQEADDVVEERIRAAVVETTGVRPHTVRMLVPGT
LPRTSSGKLRRAEALRRYLAEELAPPKKVGAVGLAVEMARSALAMVRAESDT
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggcgctggttcgcgactggtgggcccggcgttgcctccgcccaggcatctgacg
gtgaacgcggcgctcgcggacaccgggcgcacgtcgccgctggggctcaccttcgtggac
gcggccgagcgcgaggtgtccatgccctgggcggacgtgtaccgccgggcgaagcgcacc
gccgcggggctggcccggctgggcgtgagcgagggtgaccgggtggcgttgctgctgccc
acgtcgccggccttcatggatgccttcttcggcacgttgctcgcgggcgcggtgccggtg
ccgctgtacccgccggtgcggctggggcgactggacgagtaccaccgcgcgacctcgcgg
atgctccacgtgacgggctcggtgatggtcttgacggacgttcgcgtgcgcctgctgctg
gggcccagcgtggagcgcgcgcgtccccggctggggtgccacacggtggacgaggtgtcc
cggggggatgacgtgctggaggtcccggtgaggccggacgcactggggctcatccagttc
tcgtccggttccacggtggatccgaagccggtgacgctgacgcacgaagccctgctggcg
caggtcgcggcgctggagatggcgatgccgctgggggcgggggtgccccgggtgggcgtg
agctggctgccgctgtaccacgacatggggctcatcggctgtctgctgtccgcgctgtac
tacccgggaagcctggtgctgattccccccgaggccttcctcgcacggcccgcgttgtgg
ctccgcgcgctgtctcgccaccggggctacatctctcccgcgccgaacttcgcctatggc
ctgtgtttgaagcgggtgaaggacgcggagctggacggggtggacctgtcgtcgtggcgg
cacgcgctcaacggcgcggagccggtgtccgtggacacgctgcgccgcttttcggtgcgt
ttcgagcggtggggcttctccgcgcgggcgttgcggccggtgtacgggctgtccgaggcg
tcgctcgccgtcaccttcccgccggaagggcgggggccgcgcgcgctgggcgtggacgcg
gggctgctggcccgggagggccgggtggcggagggttcgcgtgagttggtgagcgtgggc
atgcccgtggcgggcttcgaggtggaggtgcgcggcgagacgggcgaggcgctcgcggag
cggtgcgtgggccgggtcttcgcgcgggggccgtccctgatggccggctacttcgcggat
gcgcaggccacggaccggacgctgacgcgggacgggtggctggacacgggcgacctgggc
ttcatcgcggagggcgagctgttcctcacgggccgggcgaaggacgtggtcatcatccga
ggcgcgaaccacgcgccgcaggcgttcgaggagccgctgcagagcgtggcgggcgtgcgc
gcgggctgcgcggtggcgctgggcttcacgcccgaagggggcgaggacgaggcgctgctc
atcctcgcggagcgttcggggcaggaggcggatgacgtggtcgaggagcgcatccgcgcg
gcggtggtggagaccacgggcgtgcggcctcacactgtgcggatgctcgtgccaggcacg
ttgccgcgcacgtccagcggcaagctgcgccgcgccgaggcgctgcgccgttacctggcc
gaggaactggcgccgccgaagaaggtgggcgcggtggggttggcggtggagatggctcgg
agcgcgctggcgatggtccgcgcggagagcgacacgtga

DBGET integrated database retrieval system