KEGG   Moritella yayanosii: MORIYA_0325Help
Entry
MORIYA_0325       CDS       T05564                                 

Definition
(GenBank) conserved exported protein of unknown function
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
mya  Moritella yayanosii
Pathway
mya00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MORIYA_0325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mya01002]
    MORIYA_0325
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
    MORIYA_0325
Enzymes [BR:mya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MORIYA_0325
   3.4.21  Serine endopeptidases
    3.4.21.-  
     MORIYA_0325
Peptidases [BR:mya01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   MORIYA_0325
Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MORIYA_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 KHA
Motif
Other DBs
NCBI-ProteinID: SQD76803
UniProt: A0A330LJD6
LinkDB All DBs
Position
MORIYA:complement(341428..342882)
Genome map
AA seq 484 aa AA seqDB search
MLRTYLYCITLYFISMSASANSDKIASLEKLLPSGTNVAYIVGQPFSSTATVSNNTASQH
NAKLLFTPASIQKLLTALTAKLYLTDEYIFNTSLHGKISKQSVSEMEFNFTGDPTFSRDD
LRNMLKRLKARGITKISGDITLNQSRFNGYNWGNGQVWNDQAICYATQASALVINNNCVL
GNLKRSADLKQATIYIPEYEPIILTSQVDIISKAQQQAQFCDLEVIRHPNNNYTLFGCIT
PSKRNLPLSFAISDPVTYFTALLNAELAQANIEFTGNVVESFQTVNTAVIVNHQSPPLAD
IITKMMKESDNLIADILFKTIGAEYFQQPGNYRNGAKAMREILAGEGLSLASNVIADGSG
LSRHNLVSTQTMFNVLVYVIRHDDELQLLDTMPISGLDGTLQYRRGLLTKKLIGKIVAKT
GSLKGLSNLVGFVKTEKNHRVPFVLMVSGYNPNAIEQDNSNQPKKKSPLTQYLAAFFNTI
FSNY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaacttacctatattgtatcactctctacttcatcagcatgagcgccagtgcg
aatagcgataaaatagcgtctttagaaaagctgcttccttcaggtacaaatgtggcctat
attgttgggcaacctttcagttcgacagcaacagtcagtaataatactgctagccagcat
aatgccaagctgttatttacacccgcctcaatacaaaagctactaacagcattaaccgca
aaactttatcttaccgacgagtatatctttaataccagtttgcacggcaaaataagtaaa
caaagtgtaagtgagatggagttcaactttaccggcgatccaacctttagcagagacgat
ctacgaaacatgcttaagcgcttgaaagcaagaggcatcacaaagattagtggcgatatc
acgctcaatcaaagtcgctttaatggttataattggggcaacggtcaagtttggaatgat
caagccatctgttatgccacccaagcatccgctttagtcataaacaataattgtgtatta
ggcaatttaaaacgctcagccgatcttaaacaagccaccatctatattccagaatatgaa
cccatcattttaactagccaagtcgatatcattagcaaagcgcagcaacaagcgcagttt
tgtgatttagaggtcatacgtcacccaaacaataattacaccttatttggttgtattacg
ccctctaaacgcaacctacccttatcatttgcgatatccgatccagtcacttattttacc
gcattacttaatgctgaattagcacaggccaacattgaatttaccggtaacgtggttgaa
agttttcaaacggtgaataccgctgtcattgttaaccaccaatcaccaccgctggcagac
attatcaccaagatgatgaaagaatcagataacttaattgcagacatattatttaaaacc
ataggagcagaatactttcagcaaccaggtaactaccgcaatggtgctaaagccatgcgt
gaaatcttggcgggtgaaggcttatcattagcatcgaatgtgattgccgatggttcagga
ctatcacgtcacaatttggtctcaacacaaacgatgttcaacgtgcttgtgtatgttatt
cgccatgatgatgaactgcaattattagatacaatgccaatatctggtctggatggcaca
ttacaatatcgtcgcggcttactgactaaaaagctgatcggtaagattgttgcaaaaaca
ggctcattaaaaggcttatccaatttagttggttttgtaaaaactgaaaaaaaccacagg
gtaccttttgtactgatggtaagtggttacaaccctaacgctatcgaacaagacaacagt
aatcaacctaagaaaaaatcaccgctaacacagtatttagcggcgttctttaacactatc
ttctctaactattaa

DBGET integrated database retrieval system