KEGG   Moritella yayanosii: MORIYA_0348Help
Entry
MORIYA_0348       CDS       T05564                                 

Gene name
mrcB
Definition
(GenBank) fused glycosyl transferase; transpeptidase, Penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
mya  Moritella yayanosii
Pathway
mya00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MORIYA_0348 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mya01003]
    MORIYA_0348 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
    MORIYA_0348 (mrcB)
Enzymes [BR:mya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     MORIYA_0348 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MORIYA_0348 (mrcB)
Glycosyltransferases [BR:mya01003]
 Polysaccharide
  Bacterial polysaccharide
   MORIYA_0348 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   MORIYA_0348 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H Beta-lactamase2 UvrB_inter
Motif
Other DBs
NCBI-ProteinID: SQD76826
UniProt: A0A330LKU6
LinkDB All DBs
Position
MORIYA:367734..370013
Genome map
AA seq 759 aa AA seqDB search
MSKNTKDNKNKQRSGLWWKLLLIPVFIGFAVMVYLDIIIRSTFDENKWAVPSTVYARPLE
LYEGAALTVADLKTELGLLGYKFVSRPTKPGQANIRGDQVGIYTPGFQFSDDLEPPRNIL
LTLQDGLVTKLDTDDGVGLLRLEPVVIGGIYPAHNEDRLLVQLSEVPESLQAMLVAVEDD
GFYDHFGISLRGIARALVANIKQGGIAQGASTLTQQLVKNYYLSSERTLSRKVQEALMAI
LLEFHFSKVDILEGYINEIYLGQDGPRAIHGFGLASQYYFKTPLAELSLDKQALLVALVR
GASYYNPWRNPERALKRRDLVLNIAVREGRLDADLAAAAKALPLGMGEQTASSTKRFPAY
LDLVRRQLQRDYKVEDLSENGLSIFTHFDPLVQSSAESSLTKAIARHKRDGLSAKLEGAV
VITRPNTGAVIAIVGGVNTRFAGFNRAIDARRQVGSLIKPAVYLTALEQPQQYNLATLIS
DDEYNLNLPNGDIWSPKNYDKKDHGQVLLYTALAKSYNQSTARLGNELGLDKIADTLRRL
GVEQTIPELPAITLGAVDMSPIAVAQMYQTLSADGFYTPLLAISAVVDPGGTVLKSYPLV
VDKRFDSSSIYMLRHAMQAVTHEGSARALQWLLPDFEVAGKTGTTNNLRDSWFAGFSGDM
MAVVWMGRDDNASIGLTGSSGALRVWAEIFRQRSELPIQNLPPQDITVVWVDKDTGQGSQ
GSCLNSIPLPFVSGYEPEIELRCNQGVKRVIEWFRELVE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagaatacaaaagacaacaagaacaaacaacgcagcggtttatggtggaaattg
ttactgatccctgtgtttattgggttcgcagtaatggtttatttagatattattattcgc
tcaacctttgatgaaaataaatgggcggtaccatcgacggtttatgcgcggccacttgaa
ttatatgaaggtgcagcattaaccgttgctgatttaaaaaccgagcttggcttattaggt
tacaaattcgtctcacgaccgacaaagcctggtcaagcaaatatacgaggtgatcaggtt
ggtatttatacgccaggcttccaatttagtgatgatttagaaccgccgcgcaatatttta
ctgacattgcaagatggtttagtgactaaacttgatactgacgatggggttggcctgtta
cgtttagagccagtcgttattggtggtatctatccagcgcataatgaagaccgtttgtta
gttcagctatccgaagtgccggaatcgttacaagcaatgttagtggcggttgaagatgat
ggtttttatgatcattttggtatttcgttgcgtggtatcgcccgtgcgttagtggcgaat
attaagcaaggtggtattgcgcaaggcgcgtctacactgactcagcaactcgttaagaac
tattatcttagttctgaacgtactttaagccgtaaagtgcaagaagcgttgatggcgatc
ctactcgaatttcatttttccaaggttgatatcttagaaggctatattaacgaaatttac
cttggtcaagacgggcctcgagccattcatggtttcggtttagccagccagtattatttc
aaaacaccacttgcagagctgtcacttgataaacaagcgttattggtcgcactcgtgcga
ggcgcaagttattacaacccatggcggaatcctgaacgagcgcttaaacgccgagactta
gtgctgaatatcgcagtacgtgaaggtcgtttggatgctgatttagcggctgcagcaaaa
gccttgccactcggcatgggagaacaaaccgcaagtagcacgaaacgattcccggcttac
cttgatttggtgcgccggcaattacagcgcgattataaagtcgaagatttaagtgaaaat
gggctatctatttttacccattttgatccgctggtgcaaagcagtgcggaatcgagttta
acaaaagccattgctcgacataagcgtgatgggttgagtgctaagcttgaaggtgctgtt
gtgataacccggccaaatacaggcgcggtgattgctattgtcggtggtgttaatacgcgt
tttgcgggttttaaccgtgctattgatgcaagacgtcaagttggttcgttaataaagcca
gcggtgtatttaaccgccttagaacaaccacaacagtataacctggcgactttaattagt
gatgatgaatataaccttaatctgcccaatggcgatatttggtcccctaaaaattatgat
aagaaagatcacggtcaggtgttgttatataccgcgttagctaagtcttataatcaatca
acagcccgtttaggtaatgaattggggttagataagatcgcagatacactgcgtcgtttg
ggtgttgagcaaacgattcctgagttacctgctattactttaggtgctgtggatatgtca
ccgattgctgtggcgcagatgtatcagacattatctgcagatggattctataccccttta
ttagcgatcagtgccgtcgtcgatcccggtggcactgtgttgaaaagttatccgttagtg
gtggataaacgttttgattcaagctcgatttatatgctgcgtcatgccatgcaggctgtt
acccatgaaggttcggcaagagcattacaatggctgttacctgattttgaagttgctggt
aaaacgggcacgaccaataatctaagagacagttggtttgctgggttttctggtgacatg
atggccgtcgtgtggatgggacgtgatgataatgcctcgattggtttaacaggctcaagt
ggtgcgttacgtgtgtgggctgaaattttccgtcaacgttctgagttaccgattcagaat
ctgccaccacaagatattaccgtggtgtgggtggataaagataccgggcaaggtagtcaa
ggtagttgtcttaactctattccactcccctttgtgagtggttatgaacccgaaattgaa
ttacgctgcaatcaaggtgttaagcgtgttattgaatggtttcgagaacttgttgaataa

DBGET integrated database retrieval system