KEGG   Moritella yayanosii: MORIYA_3158Help
Entry
MORIYA_3158       CDS       T05564                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mya  Moritella yayanosii
Pathway
mya03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mya00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MORIYA_3158 (mutM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mya03400]
    MORIYA_3158 (mutM)
Enzymes [BR:mya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MORIYA_3158 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MORIYA_3158 (mutM)
DNA repair and recombination proteins [BR:mya03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MORIYA_3158 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS Zn_Tnp_IS1595 zf-TFIIB Lar_restr_allev
Motif
Other DBs
NCBI-ProteinID: SQD79614
UniProt: A0A330LRL3
LinkDB All DBs
Position
MORIYA:3226235..3227047
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVSRQGIAPYLENAQITQIIVRNGQLRWPVPMALQDAVGCTVISVRRRAKYLL
LETEKGTIIIHLGMSGSLRVLDSSVAVEKHDHVDIVLNSGKCLRLNDPRRFGSVLWQVGD
VLEHKLLASLGPEPLTDDFTAQRLFDRSRTRKIPVKSFLMDNHIVVGVGNIYANEALFSA
GISPKRAAGKVSLQRYKVLVEEVKLVLAKAIAQGGTTLKDFTQADGKPGYFVQELQVYGK
AGKPCPKCGEELKAMKIGQRNTIYCNQCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccggaagtggaagtaagccgtcaaggcattgctccttatcttgaaaac
gcccagatcacgcagataatcgtgcgtaatgggcaattacgttggccagtgccgatggcg
ttgcaagatgcagtgggttgtactgtgataagtgtgcgtcgccgggctaaatatttatta
ttagagacggaaaaaggcaccatcatcattcacttgggcatgtcaggtagtctaagagtg
cttgattcaagcgtcgcagtcgaaaagcatgatcatgtagatatcgtgttgaattcaggt
aaatgtcttcgcctgaacgatcctagacgttttggttcggtgttgtggcaagttggtgat
gtacttgaacataaattattagccagtttaggaccagagccgttaacagatgattttacg
gcacaacgtttgtttgaccgttctcgtacacgaaaaataccggttaagtcatttctgatg
gataaccatattgttgtgggggttggtaacatttatgctaacgaagcgttattctcggcg
gggatcagtccgaaacgggcggcaggtaaggtgtctttacaacgttacaaggtacttgtt
gaggaagtcaaactggtattagccaaagcgattgcgcaaggcggcaccacgttaaaggat
tttacccaggccgatggtaaacccggttattttgtgcaggaattgcaggtatacggcaaa
gccggcaaaccgtgtcccaagtgtggtgaggaattaaaagcgatgaagatcggtcagcgc
aacacgatttattgtaatcaatgccagcgctaa

DBGET integrated database retrieval system