KEGG   Moritella yayanosii: MORIYA_3465Help
Entry
MORIYA_3465       CDS       T05564                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mya  Moritella yayanosii
Pathway
mya00473  D-Alanine metabolism
mya00550  Peptidoglycan biosynthesis
mya01100  Metabolic pathways
mya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MORIYA_3465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MORIYA_3465
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MORIYA_3465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
    MORIYA_3465
Enzymes [BR:mya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MORIYA_3465
Peptidoglycan biosynthesis and degradation proteins [BR:mya01011]
 Precursor biosynthesis
  Amino acid ligase
   MORIYA_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: SQD79920
UniProt: A0A330LSU5
LinkDB All DBs
Position
MORIYA:complement(3551365..3552360)
Genome map
AA seq 331 aa AA seqDB search
MKIEIITTPNEKLKETGFGTFKACHGVLDAINRMGYTAKLSVCETVSDLDKVIERKPNLV
VLAVKYIPTGNNGNIWLADYFMKHEINFTGSLREVLEFDSNKVLAKSHLQSKGIATAKYF
TAIPGQYNCKSELPIKFPLFLKPTDAANGNGIDDLSFVTSFPEFEAKILSLHELFRIPIL
VEEYLDGREFTVAVIRKSDGELIVSPIEIIPPESTNGLRILGGKVKNDNSEELKRIEDDE
IKHRVKQLAINSFINLGVRDFGRIDIKANKDGKCFFIEANLVPGMTPGSSYFPKSCEIEL
GLTYEKVIQIILENGLSRAKSAVSPNQAIQI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgagatcatcacaactccaaatgaaaagttgaaagagactgggtttggcact
tttaaagcttgtcatggtgtgttagatgcaataaacagaatgggatatactgcaaaacta
agtgtttgtgaaacagtgagtgacttagataaagtgatagaaagaaaaccaaacttagtc
gttctagcggttaagtatatcccaactggtaacaatggtaatatttggttggctgactat
ttcatgaagcatgaaattaacttcactgggtcattaagggaagtcttggaatttgattca
aataaggttctcgctaaatcccatttgcagagtaaagggattgcaactgctaaatatttc
acagcgatccctggtcagtataattgtaaaagtgaattgccaattaaattccccttgttc
ttgaaaccaactgatgcagcaaatggcaacggtatcgacgatctttcgtttgtaactagt
tttccagagttcgaagctaagatattgtcattacatgaattatttagaattccaatattg
gttgaagaatatttggatggtcgggaatttacagttgctgtaataagaaaatcggatggc
gaattaattgtttcacctattgagattattccacctgaatcaacgaatggactgagaatt
ttgggggggaaagtgaaaaatgacaactctgaagaactgaaacgaattgaagacgatgag
ataaaacatagggttaaacaacttgctattaattctttcattaaccttggtgtaagggat
tttggaagaatagacattaaagcgaacaaagatggaaaatgtttttttattgaagccaat
ttggttcctggcatgacacctggttcgagttatttcccaaaatcatgtgagattgagctt
ggattaacttatgagaaagtgatccaaataatattagagaacgggcttagtcgagcaaaa
tcagccgtatcacctaaccaagccatccaaatttaa

DBGET integrated database retrieval system