KEGG   Myotis brandtii (Brandt's bat): 102239648Help
Entry
102239648         CDS       T02920                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102239648 (GPD2)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102239648 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_5 EF-hand_9 HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox EF-hand_10 Pyr_redox_3 EF-hand_4 Thi4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 102239648
NCBI-ProteinID: XP_014389557
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFKKAVKGTILAGGGALATILGLSQFAHYRRKQMTLAYVRAAENVSEPVNKDPPSREAQ
ILTLRNTPEFDVLVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKMY
DLVAGSNCLKSSYILSKSRALEHFPMLQKDRLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVLSLLKKTDPQTGKERVSGARCKDILTGQEFDVRAKCVINATGPFTDAVRQM
DDKDAATICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
ITHHPIPSEEDINFILNEVRNYLSHDVEVRRGDVLAAWSGIRPLVTDPKSANTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKAHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLASTYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWNDAKKQEELETAKKFLY
FEMGYKSRSEQLTDHSEICLLPSDVDRYKKRFHKFDTDQKGFITTVDVQRVLESINIQMD
ENTLHEILNEVDLNKNGQVELDEFLQLMSAIQKGRVSGSRLAILLKTAEENLEGRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaagaaggcagtaaaagggacaattcttgctggaggaggtgctcttgcaact
attctaggcctctctcagtttgcccattacagaaggaagcaaatgaccctggcctatgtt
agagcagccgagaacgtttcagaaccagtgaacaaggatcctccttcccgagaagctcag
atactgactttgagaaacacgcctgaattcgatgtccttgtcattggaggaggagcgaca
gggtgtggctgtgcactagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcggggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcacgagcgcgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccagtttacaagtggtggcagttaccttactactgggtaggaatcaaaatgtac
gacctggtggcaggaagtaactgcctgaaaagcagttacatcctcagcaaatcgagagcc
ctggagcatttcccaatgcttcagaaggacaggctggtaggagcaattgtctactatgat
ggacaacacaacgacgcacggatgaaccttgccattgctctcactgctgccaggtatggg
gctgccacagccaattacatggaggtcctgagcttgctgaagaagacagacccccaaaca
gggaaagagcgcgtgagcggcgcgcggtgcaaggacatactcacaggacaggaatttgat
gtgagagccaaatgtgttatcaatgccacgggacctttcacagacgccgtgcgccaaatg
gatgataaggatgccgcaactatctgccagccgagtgctggggtccacattgtgatgcct
ggttactacagcccagagagcatgggacttcttgacccagcgaccagtgatgggcgagtt
attttcttcttaccgtggcaaaagatgactatagctggcactaccgacactccaaccgat
attacacaccatcctattccttcggaagaagacatcaacttcattttgaacgaagtgcgt
aattacctgagtcatgatgttgaagtgaggagaggggatgtcctggcagcgtggagtggt
attcgtccccttgtgacagatcctaagtctgcaaacactcagtccatctcccggaatcat
gttgtggatatcagcgagagcggcctcatcacgatagcagggggaaagtggacaacctat
cgctctatggcagaagataccataaatgctgctatcaaggctcataatttgaaagcagga
ccaagtagaacagttgggctttttcttcaagggggcaaagattggagccccacactctac
atcaggcttgtccaagattatggacttgaaagtgaggtggcacagcatcttgcctccacc
tatggggacaaggcctttgaggtggccaaaatggccagtgtgactggaaaaaggtggccc
attgttggagtgcgtctggtgtcagaatttccatacattgaagcagaggtgaaatatggg
attaaggagtatgcctgcaccgcagtggatatgatttcacgtcgcactcgcctggctttt
ctaaatgtccaggcagcggaggaagccctacccaggattgttgagctgatgggcagagaa
ctgaattggaatgatgctaaaaaacaggaagaacttgaaacagctaagaagtttctgtat
ttcgaaatgggttataaatctcgatcagaacagttaacagatcactctgaaatttgcctg
ctgccttcagacgttgacaggtacaagaagagatttcataagtttgatacagaccaaaag
ggctttattaccactgttgatgttcagcgtgtattagagagtatcaatatccaaatggat
gaaaacacactacatgaaattctgaatgaagtagatttgaacaaaaatggacaagttgaa
ctcgatgaatttttgcagctgatgagtgctattcagaaaggaagggtgtctggaagccgg
ctggcaatcctactgaaaacggcggaagagaacctggaaggaagggttcccattccggtg
gacagaagttgtggaggattgtga

DBGET integrated database retrieval system