KEGG   Myotis brandtii (Brandt's bat): 102239853
Entry
102239853         CDS       T02920                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb01521  EGFR tyrosine kinase inhibitor resistance
myb04062  Chemokine signaling pathway
myb04066  HIF-1 signaling pathway
myb04068  FoxO signaling pathway
myb04217  Necroptosis
myb04550  Signaling pathways regulating pluripotency of stem cells
myb04630  JAK-STAT signaling pathway
myb04659  Th17 cell differentiation
myb04917  Prolactin signaling pathway
myb04920  Adipocytokine signaling pathway
myb04931  Insulin resistance
myb04933  AGE-RAGE signaling pathway in diabetic complications
myb04935  Growth hormone synthesis, secretion and action
myb05145  Toxoplasmosis
myb05160  Hepatitis C
myb05161  Hepatitis B
myb05162  Measles
myb05163  Human cytomegalovirus infection
myb05167  Kaposi sarcoma-associated herpesvirus infection
myb05169  Epstein-Barr virus infection
myb05200  Pathways in cancer
myb05203  Viral carcinogenesis
myb05205  Proteoglycans in cancer
myb05206  MicroRNAs in cancer
myb05212  Pancreatic cancer
myb05221  Acute myeloid leukemia
myb05223  Non-small cell lung cancer
myb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102239853 (STAT3)
   04066 HIF-1 signaling pathway
    102239853 (STAT3)
   04068 FoxO signaling pathway
    102239853 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102239853 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102239853 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102239853 (STAT3)
   04062 Chemokine signaling pathway
    102239853 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102239853 (STAT3)
   04917 Prolactin signaling pathway
    102239853 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102239853 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102239853 (STAT3)
   05206 MicroRNAs in cancer
    102239853 (STAT3)
   05205 Proteoglycans in cancer
    102239853 (STAT3)
   05203 Viral carcinogenesis
    102239853 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102239853 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102239853 (STAT3)
   05221 Acute myeloid leukemia
    102239853 (STAT3)
   05223 Non-small cell lung cancer
    102239853 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102239853 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102239853 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102239853 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102239853 (STAT3)
   05161 Hepatitis B
    102239853 (STAT3)
   05160 Hepatitis C
    102239853 (STAT3)
   05163 Human cytomegalovirus infection
    102239853 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102239853 (STAT3)
   05169 Epstein-Barr virus infection
    102239853 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102239853 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102239853 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myb03000]
    102239853 (STAT3)
Transcription factors [BR:myb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102239853 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Fib_alpha
Other DBs
NCBI-GeneID: 102239853
NCBI-ProteinID: XP_005875791
LinkDB
Position
Un
AA seq 841 aa
MNLYLKLPCGEEAALSFSAKQVLTHQLSGFGSERTRRKGLPVVSWPYVRWRKPAELERES
KPSVGTPDSSRMAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASK
ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCL
WEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQ
DDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAME
YVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQ
KVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKV
RLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFK
HLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQ
MPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLA
EKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFI
SKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMS
FAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTK
FICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSP
M
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgaatttgtatttgaaattgccttgcggtgaagaagcagcactcagcttctctgcaaaa
caggttctcacacaccagctctccggttttggatcggagaggacaagaaggaaaggcctt
ccagttgtttcttggccatacgtgcgctggaggaagccagcagagcttgaaagagaaagt
aaaccttctgttgggacccctgattccagcaggatggcccaatggaatcagctacagcag
ctcgacacacggtacctggagcagcttcatcagctgtacagtgacagcttcccaatggag
ctgcggcagttcctggccccttggattgagagtcaagattgggcttatgcagccagcaaa
gaatcacatgccactttggtgtttcataatctcttgggtgagattgaccagcagtacagc
cgcttcctacaagaatcaaatgttctctatcagcacaatctgcgaagaatcaagcagttc
cttcagagcaggtatcttgagaagcctatggagattgcccgaattgtggcccggtgcctg
tgggaagagtcccgcctcctccaaactgcagccactgcagcccagcaagggggccaggcc
aaccaccccacagctgccgtggtgacagagaagcagcagatgctggagcagcacctacag
gacgttcggaagcgagtacaggatctagaacagaaaatgaaagtggtagagaatctccag
gatgactttgatttcaactataaaaccctcaagagtcaaggagacatgcaagatctgaat
ggaaacaaccagtcagtgaccaggcagaagatgcagcagctagaacagatgctaactgct
ctggaccagatgcggcgaagtatcgtgagtgagctggcggggcttttgtcagctatggag
tatgtgcagaaaactctcacggatgaggagctggctgactggaagaggcggcaacagatt
gcttgcattggaggccctcccaacatctgcttagatcgtctagaaaactggataacctca
ttagcagaatctcaacttcagacgcgccaacaaattaagaaactggaggagttgcagcaa
aaagtttcctacaaaggggaccccattgtacagcaccggccaatgctggaggagagaatt
gtggaactctttagaaacttaatgaaaagtgcctttgtggttgagcggcagccctgcatg
cccatgcatcccgaccggccattagtcatcaagaccggtgtccagtttactactaaagtc
agattgctggtcaaattccccgagttaaattatcagcttaaaattaaagtgtgcattgac
aaagactccggggatgtagcagctctccgaggatccaggaaatttaacattctgggcaca
aacacaaaagtcatgaacatggaagaatccaacaacggcagcctctctgcagaattcaaa
cacttgaccctgagagagcaaagatgtgggaatgggggccgagccaattgtgacgcctcc
ctgattgtgaccgaggagctgcacctgatcacctttgagactgaggtgtatcaccaaggc
ctcaagattgacctagagacacactccctgccagtggtggtgatttccaacatctgtcag
atgccaaatgcttgggcatccatcctgtggtataacatgctgaccaacaaccccaagaac
gtgaactttttcacaaagcccccaattggaacctgggatcaggtggccgaggtgctgagc
tggcagttctcttccaccacgaagcgagggttgagcatcgaacagttgactacgctggca
gagaaactcctaggacctggtgtgaactattcagggtgtcagatcacatgggctaaattt
tgcaaagaaaacatggctggcaagggcttctccttctgggtctggctggacaatatcatt
gaccttgtgaaaaagtacattctggccctttggaatgaagggtacataatgggctttatc
agcaaggaaagagagagggccatcttgagcaccaagcccccaggtaccttcctgctaaga
ttcagtgaaagcagcaaagaaggaggtgtcaccttcacttgggtggagaaggacatcagc
ggtaagacacagatccagtcggtggaaccatatactaagcagcagctgaacaacatgtca
ttcgcggaaatcatcatgggctataagatcatggacgctaccaatatcctggtgtctcca
ctggtctatctctaccccgacattcctaaggaggaggcgttcggaaagtattgtcggcca
gagagccaggagcatcctgaggctgacccaggtagtgctgccccctacctgaagaccaag
ttcatctgtgtgacaccaacgacctgcagcaataccattgacctgccgatgtccccccgc
actttagattcattgatgcagtttggaaataatggtgaaggtgctgaaccctcagcagga
gggcagtttgagtccctcacattcgacatggagctgacctcagagtgtgctacctccccc
atgtga

DBGET integrated database retrieval system