KEGG   Myotis brandtii (Brandt's bat): 102240225
Entry
102240225         CDS       T02920                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04010  MAPK signaling pathway
myb04020  Calcium signaling pathway
myb04022  cGMP-PKG signaling pathway
myb04024  cAMP signaling pathway
myb04260  Cardiac muscle contraction
myb04261  Adrenergic signaling in cardiomyocytes
myb04270  Vascular smooth muscle contraction
myb04713  Circadian entrainment
myb04720  Long-term potentiation
myb04723  Retrograde endocannabinoid signaling
myb04724  Glutamatergic synapse
myb04725  Cholinergic synapse
myb04726  Serotonergic synapse
myb04727  GABAergic synapse
myb04728  Dopaminergic synapse
myb04742  Taste transduction
myb04911  Insulin secretion
myb04912  GnRH signaling pathway
myb04921  Oxytocin signaling pathway
myb04924  Renin secretion
myb04925  Aldosterone synthesis and secretion
myb04927  Cortisol synthesis and secretion
myb04929  GnRH secretion
myb04930  Type II diabetes mellitus
myb04934  Cushing syndrome
myb04935  Growth hormone synthesis, secretion and action
myb05010  Alzheimer disease
myb05020  Prion disease
myb05022  Pathways of neurodegeneration - multiple diseases
myb05031  Amphetamine addiction
myb05410  Hypertrophic cardiomyopathy
myb05412  Arrhythmogenic right ventricular cardiomyopathy
myb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:myb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102240225 (CACNA1C)
   04020 Calcium signaling pathway
    102240225 (CACNA1C)
   04024 cAMP signaling pathway
    102240225 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102240225 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102240225 (CACNA1C)
   04929 GnRH secretion
    102240225 (CACNA1C)
   04912 GnRH signaling pathway
    102240225 (CACNA1C)
   04921 Oxytocin signaling pathway
    102240225 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102240225 (CACNA1C)
   04924 Renin secretion
    102240225 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102240225 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102240225 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102240225 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102240225 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102240225 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102240225 (CACNA1C)
   04727 GABAergic synapse
    102240225 (CACNA1C)
   04725 Cholinergic synapse
    102240225 (CACNA1C)
   04728 Dopaminergic synapse
    102240225 (CACNA1C)
   04726 Serotonergic synapse
    102240225 (CACNA1C)
   04720 Long-term potentiation
    102240225 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102240225 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102240225 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102240225 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102240225 (CACNA1C)
   05020 Prion disease
    102240225 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102240225 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102240225 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102240225 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102240225 (CACNA1C)
   05414 Dilated cardiomyopathy
    102240225 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102240225 (CACNA1C)
   04934 Cushing syndrome
    102240225 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myb04040]
    102240225 (CACNA1C)
Ion channels [BR:myb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102240225 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102240225
NCBI-ProteinID: XP_014394910
LinkDB
Position
Un
AA seq 1903 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGR
QCQNGTVCKPGWDGPRHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY
FVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSR
YWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALL
ALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKVMSPLGISVLRCVRL
LRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKI
ELKSITADGESPPTTKINMDDLQPNENEDKGVYPNPEATGEEDEEEPEMPVGPRPRPLSE
LHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQ
HTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRNWENSKFDFDNVLAA
MMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYL
MFVLILLNTICLAMQHYGQSCLFKMAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWN
VFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSDSMN
AEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAV
IGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESE
PHNSTEGEAPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDE
FKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTV
MFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVG
KFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE
EELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDSRSTFPQTFTTQRPLHINKATNS
PGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPRPTRYPSSVSAVEGHGP
PLSPAIRVQEAAWKLSSKRCHSRESQIAMVCREEFSQDETYDVQMGDDAEYCSEPSLVST
DKLSYQDEESRQLAPPEDRRDTRQSPKRGFLRSASLGRRASFHLECLKRQKNQGGDISQK
TVLPLHLVHHQALAVAGLSPLLQRSHSPTTFPRPCATPPATPSSRGWPPQPIPTLRLEGT
ESTEKLNSSFPSVHCSSWSGEPTPCEGSSSATRRARPVSLTVPSQAGAWGRQFHGSASSL
VEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLP
FVNCRDQGQDRAGGEEPGPCGPSQEPQRSEEELQDSRAYVSSL
NT seq 5712 nt   +upstreamnt  +downstreamnt
atggttcccctgctgcacatcgccctgctagtgctgtttgtcatcattatctatgctatc
attggcctggaactcttcatggggaaaatgcataagacctgctacaaccaggagggcata
gcagatgttccagcggaagatgatccctccccttgtgctctggagacaggccatggacgg
cagtgtcagaatggcactgtgtgcaagcctgggtgggatgggcccaggcacggcatcacc
aacttcgacaacttcgccttcgccatgctcacggtgttccagtgcatcaccatggaaggc
tggacagacgtgctatactggatgcaggacgctatgggctatgagttaccctgggtgtat
tttgtcagtctggtcatctttggatcctttttcgttctaaatctggttctcggtgtgttg
agcggagagttctccaaagagagggagaaggccaaggctcggggggatttccaaaagcta
cgagagaagcaacaactggaagaggacctgaaaggctacctggactggatcacacaggcg
gaagacattgaccctgagaacgaggacgaaggcatggatgaggagaaaccccgaaacatg
agcatgcccacaagtgagacggagtctgtcaacactgagaacgtggctggtggtgacatc
gagggagaaaactgtggggccaggctggcccaccggatctccaagtcaaagttcagtcgc
tactggcgccggtggaatcggttctgccgaaggaagtgtcgtgccgcagtcaagtccaat
gtcttctactggctcgtgattttcctggtgttcctcaacacgctcaccattgcctcggag
cattacaaccagccgcactggctcacagaagtccaagacacggccaacaaggcgctcctg
gccctgttcactgcggagatgctgctgaagatgtacagcctgggcctgcaggcctacttc
gtgtccctcttcaaccgcttcgactgcttcattgtgtgcgggggcatcctggagaccatc
ctggtggagaccaaggtcatgtcccccttgggcatctctgtgctgagatgtgttcggctc
ctgaggatatttaaaatcaccaggtactggaactccttaagcaacctggtggcatccttg
ctgaactccgtgcgctccatcgcctccctgctactactgctcttcctcttcatcatcatc
ttctccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagact
cggaggagcacgtttgataactttccccagtccctcctcaccgtgtttcagatcctgacc
ggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctctttt
ccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatccta
ctgaatgtgttcttggccattgctgtggacaacctggctgatgctgagagcctcacatct
gcccagaaggaggaagaagaagagaaggagagaaagaagctggccaggactgccagccca
gagaagaaacaggaggtggtggagaagccagcagtggaggagaccaaggaggagaaaatt
gagctgaaatccattacagctgacggagagtccccgcccaccaccaagatcaacatggat
gacctccagcccaatgaaaatgaggacaagggtgtctaccccaacccggaagcgacagga
gaggaggatgaggaggagcctgagatgcccgtgggcccacgcccacgcccactctcggag
ctgcacctcaaggaaaaggcagtgcccatgcctgaagccagtgcatttttcatcttcagc
cccagcaacaggtttcgcctccagtgccaccgcattgtcaatgactcgatcttcaccaac
ctgatcctcttcttcatcctgctcagcagcatttccctggctgcggaggacccggtccag
cacacctccttcaggaaccatatcctaggcaatgcagactatgtcttcactagtatcttt
acattagaaattatccttaagatgactgcttatggggctttcctgcacaagggctccttt
tgccggaactacttcaacatcttggacctgctagtggtcagcgtgtccctcatctccttt
ggcatccagtccagtgcgatcaatgttgtaaagatcttgcgagttctgcgtgtactcagg
cccctgagagccatcaaccgagccaaggggctaaagcatgtggtccagtgtgtgttcgtg
gccatccgcaccatcgggaacatcgtgattgtcaccacgctgctgcagttcatgttcgcc
tgcatcggggtccagctcttcaagggaaagctctacacctgttcagacagttccaagcag
acggaggcggaatgcaagggaaactacatcacgtacaaggacggggaggttgaccacccc
atcatccagccccgcaactgggagaacagcaagtttgactttgacaatgtcctggcagcc
atgatggctctcttcaccgtctccacctttgaggggtggccagagctgctgtaccgctcc
atcgactcccacacggaagacaagggccccatatacaactaccgtgtggagatctccatc
ttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtgggtttc
gtcatcgtcaccttccaggagcagggagagcaggaatacaagaactgtgagctggacaag
aaccagcgtcagtgtgtagaatatgccctcaaggcccgacccctgcggaggtacataccc
aagaaccagcaccagtacaaagtgtggtatgtggtcaactccacctactttgagtacctg
atgttcgtcctcatcctgctcaacaccatctgcttggccatgcagcactacggtcagagc
tgcctgtttaaaatggccatgaacatcctcaacatgctcttcactggcctcttcactgtg
gagatgattctgaagctcattgcctttaaacccaagggttactttagtgatccctggaat
gtttttgacttcctcatcgtaattggcagcataattgacgtcattctcagtgaaactaat
cactatttctgtgatgcatggaatacgtttgacgccttgattgttgtgggtagcattgtt
gatatagcaatcaccgaggtaaacccagctgaacatacccaatgctctgactctatgaat
gcagaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctg
gtcaagctgctgagccgtggggagggcatccggacgctgctgtggaccttcatcaagtcc
ttccaggccctgccctacgtggcccttctgatcgtgatgctgttcttcatctatgccgtg
atcgggatgcaggtgtttgggaaaattgccttgaatgacactacagagatcaaccggaac
aacaactttcagaccttcccccaagctgtgctgctcctcttcaggtgtgccaccggggag
gcatggcaggacatcatgctggcctgcatgccagggaagaagtgcgccccggagtctgaa
ccccacaacagcacggaaggggaggcgccctgtggcagcagcttcgccgtcttctacttc
atcagcttctacatgctctgtgccttcctgattatcaacctcttcgtagctgtcatcatg
gacaactttgactacctgacaagggactggtcaatccttggtccccaccatttggacgaa
tttaaaagaatctgggcagagtatgaccctgaagccaagggtcgtatcaaacacctggat
gtggtgaccctgctccggcggattcagcccccactgggttttgggaagctgtgccctcac
cgtgtggcttgcaaacgtctggtctccatgaatatgcctctgaacagtgatgggacggtc
atgttcaatgccaccctatttgccctggtccggacagccctgaggatcaaaacagaaggg
aacctggaacaagccaatgaggagctgcgggccataatcaagaagatctggaagcggacc
agcatgaagctgctggaccaagtagtgccccccgcgggtgatgatgaggtcacggtcggc
aagttttatgctactttcctgatccaagagtacttccggaaattcaagaagcgcaaagag
cagggcctcgtgggcaagccctcccagaggaacgccttgtccctgcaggctggcttgcgc
acgctgcacgacatcgggcccgagatccgacgggccatctccggagacctgacagcagag
gaggaactagacaaagccatgaaggaggctgtgtctgccgcctctgaagacgacatcttc
aggagggccggtggcctgtttggcaaccatgtcagctactaccaaagcgacagccggagc
accttcccccagaccttcaccactcagcgcccgctgcacatcaacaaggccaccaacagc
ccaggcgacaccgagtccccgtcccatgagaaactggtggactccaccttcacccccagc
agctactcatccactggctccaatgccaacatcaacaacgccaacaacactgccctgggc
cgctttccccgccccacccgctaccccagctccgtcagcgccgtggagggccatgggccc
cccttgtctcccgccatccgggtgcaggaggcagcgtggaagctcagctccaagaggtgc
cactcccgggagagccagatagccatggtgtgtcgggaggagttttctcaggacgagacc
tacgacgtgcagatgggtgacgacgcggagtactgcagtgagcccagcctggtctccaca
gacaagctctcctaccaggatgaggaaagccggcagttggcaccgccagaggacaggagg
gacacccggcaatctccaaagaggggcttcctccgctcggcctccctgggtcggagggcc
tccttccacctcgaatgtctgaagcgacagaagaatcaagggggagacatctctcagaag
acagtcctgcccttgcatctggttcatcaccaggcattggcagtggcgggcctgagcccc
ctcctccagagaagccattctcccaccacgttcccccggccgtgtgccaccccgccggcc
acgcccagcagccgaggctggcccccgcagcccatccccacccttcggctggaaggaact
gagtccactgagaaactcaacagcagcttcccatccgtccactgcagctcctggtcgggg
gagcccacgccctgcgaggggagcagcagcgccacgcggagagcccggccggtgtccctc
actgtgcccagccaggccggggcctggggcaggcagttccacggcagtgccagcagtctg
gtggaagcagtcttgatttcggaaggactggggcagtttgcccaagatcccaagtttatc
gaggtcacaacccaggagctggctgacgcctgcgacatgaccatcgaggagatggagaac
gctgcagacaacatcctcagtgggggcgcccagcagagccccaacggcaccctcttacct
tttgttaactgcagggaccaggggcaggacagagcagggggcgaggagcccgggccctgt
gggcccagccaggagcctcagaggagcgaggaggagctgcaggacagcagagcctacgtc
agcagcctgtag

DBGET integrated database retrieval system