KEGG   Myotis brandtii (Brandt's bat): 102240483Help
Entry
102240483         CDS       T02920                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00020  Citrate cycle (TCA cycle)
myb00190  Oxidative phosphorylation
myb01100  Metabolic pathways
myb01200  Carbon metabolism
myb04714  Thermogenesis
myb04932  Non-alcoholic fatty liver disease (NAFLD)
myb05010  Alzheimer disease
myb05012  Parkinson disease
myb05016  Huntington disease
Module
myb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
myb_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102240483 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102240483 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102240483 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102240483 (SDHA)
   05012 Parkinson disease
    102240483 (SDHA)
   05016 Huntington disease
    102240483 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102240483 (SDHA)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102240483 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 102240483
NCBI-ProteinID: XP_014404189
LinkDB All DBs
Position
Un
AA seq 781 aa AA seqDB search
MPLGPRSPGLRTPHLKERRRACPRSRRQVAACRCPRPWNPQRPIELAWRRDLAFGRRRRR
GGALPTVRTDPRSPSVGRCCSRGPGGVRARAPRQPRLCRLRRGEVERVSNSRTSACLATV
CKIWAPFEKAQLCVHTEAWQRPLSSGSRGFDFTVDGSKRSSAKVSDSISTQYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFSTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTKDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGY
IHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGA
GCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDH
VYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNFKGQVLR
HVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPP
IKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKISQLY
GELKHLKTFDRGMVWNTDLLETLELQNLMLCALQTIYGAEARKESRGAHAREDYKDRVDE
YDYSKPIQGQQKKPFEQHWRKHTLSYVDVGTGKVSLKYRPVIDKTLNESDCATVPPAIRS
Y
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgccccttgggccaaggtctcctggcctccgcaccccgcacttgaaggagaggaggagg
gcctgcccaaggtcacgccggcaggtagcggcctgccggtgccccaggccttggaatccc
caaaggcccatagaactggcgtggaggcgggaccttgcgtttggccggaggcgccggcgg
ggcggggcactgcctacagtccggactgatccccgcagcccctcggtggggcgatgttgc
agccgaggccccggtggggttcgagcccgtgctccccgccagccccgtctttgccgctta
aggcggggtgaggtggaacgcgtgtctaacagccgcacctcggcttgccttgcaactgtt
tgcaaaatctgggctcctttcgagaaagcgcagttgtgtgtccacaccgaggcctggcaa
cggccgttatcatcgggatcccgtggttttgacttcactgttgatgggagtaagaggtcg
tctgctaaagtttcagattcaatttctacacaatacccagtagtggatcatgaatttgac
gctgtggtggttggcgctggaggggcaggcttgcgagctgcgtttggcctttctgaggca
gggtttagcaccgcatgtgttacaaagctctttcccaccaggtcccacactgtggcagcc
cagggaggaatcaatgctgctctggggaacatggaggaggacaactggaggtggcacttc
tatgacaccgtgaagggctctgactggctgggagaccaggatgccatccactacatgaca
gagcaggcccccgcctctgtgattgagctagagaattatggcatgccatttagcagaacc
aaggatgggaagatctaccagcgggcctttgggggacagagcctcaagtttgggaaaggt
ggacaagcccatcggtgctgctgcgtcgctgaccgcaccggccactcactgctgcacacg
ttgtatggaaggtctttgcgatatgataccagctattttgtggagtattttgccttggat
cttctgatggaaaatggggaatgtcgtggtgttattgcactgtgcatagaagacgggtac
atccaccgcatcagagcaaagaacactgttatagctactggaggctatgggcgcacctac
tttagctgcacgtctgcccacactagcaccggagatggcactgcaatggtcaccagggca
ggccttccctgccaggacttggagtttgttcagttccaccccacaggcatctatggtgct
ggttgtctcatcacagaagggtgccgtggagagggcggcattctcattaacagtcaaggc
gagaggttcatggagcgctatgccccggtggccaaggacctggcctccagagacgtcgtg
tcccggtccatgactctggaaatccgagaaggaagaggctgtggccctgagaaagatcac
gtctacctgcagttgcaccacctgcccccggagcagctcgccatgcgcctgcctggcatt
tcagagacggccatgatctttgcgggtgtggacgtcaccaaggagccgatccctgtcctt
cccaccgtgcactataacatgggtggcattcccaccaacttcaagggacaggttctgagg
catgtgaacggccaggaccaggttgtgcctggcctgtacgcttgtggggaggccgcctgc
gcctcggtgcatggtgccaaccgtcttggggcaaactcactcttggacctggtcgtcttt
ggccgggcatgtgccttgagtatcgcagagtcctgcagacccggagataaagttccccct
attaaagcaaatgctggggaagaatctgtcatgaatcttgacaagttgagatttgctgat
ggaagcataagaacatcggagctacgactcaacatgcagaagtcgatgcagaatcatgcc
gcagtgttccgtgtgggcagtgtattacaggagggctgtgagaaaatcagccagctatac
ggggagctaaaacatctgaagacgtttgacagaggaatggtctggaacacagacctgctg
gagaccttggagctgcagaacctgatgctctgtgctcttcagaccatttatggagcagag
gcccggaaggagtcacgtggtgctcatgctcgggaagattacaaggaccgggttgatgag
tatgattattccaagcccatccaggggcagcagaagaagccatttgagcagcactggagg
aagcacaccctttcctatgttgatgttgggactgggaaggtttctctgaaatacagacct
gtaatcgacaaaactttaaatgagtctgactgcgccacagtccccccagccattcgctcc
tactga

DBGET integrated database retrieval system