KEGG   Myotis brandtii (Brandt's bat): 102240957Help
Entry
102240957         CDS       T02920                                 

Definition
(RefSeq) N-lysine methyltransferase SETD8
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:myb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102240957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myb03036]
    102240957
Enzymes [BR:myb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102240957
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102240957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102240957
NCBI-ProteinID: XP_005875544
LinkDB All DBs
Position
Un
AA seq 186 aa AA seqDB search
MSWRPTVGDLVVWPRWVQSGLGGRLTRPVFSSQFEERRRLDELIESGKEEGMKIDLIDGK
GRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDA
TRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASIEA
YPWLKH
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggaggccgactgtgggtgaccttgtggtgtggccccgctgggtccagagtggc
ctgggaggaaggctgacgcgccccgtgttttcttcccagtttgaagaaaggagaagacta
gacgaattgatcgaaagtgggaaggaagaaggcatgaagattgacctcatcgatggcaaa
ggcaggggcgtgatcgccaccaagcagttctcccggggcgattttgtggtggaataccac
ggggacctcatcgagatcaccgacgccaagaagcgggaggctctgtatgcgcaagacccc
tccaccggctgctacatgtactatttccagtatttgagcaaaacctactgcgtggatgca
actagagagacaaatcgcctgggaagactgatcaatcacagtaaatgtgggaactgccaa
accaaactgcacgacatcgacggcgtgcctcacctcatcctcatcgcctcccgcgacatc
gaggcgggggaggagctcctgtacgactatggggaccgcagcagggcctccatcgaggcc
tacccctggctgaagcattaa

DBGET integrated database retrieval system