KEGG   Myotis brandtii (Brandt's bat): 102242515Help
Entry
102242515         CDS       T02920                                 

Gene name
TIMP3
Definition
(RefSeq) TIMP metallopeptidase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb05205  Proteoglycans in cancer
myb05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102242515 (TIMP3)
   05205 Proteoglycans in cancer
    102242515 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:myb01002]
    102242515 (TIMP3)
Peptidases and inhibitors [BR:myb01002]
 Peptidase inhibitors
  Family I35: timp family
   102242515 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 102242515
NCBI-ProteinID: XP_005861707
LinkDB All DBs
Position
Un
AA seq 211 aa AA seqDB search
MTPWLGLVVLLGTWSLGYWGAEACTCSPTHPQEAFCNSDIVIRARVVGKKLVKEGPYGTL
IYTIKQMKMYRGFTKMPHVQYIHTEASESLCGVKLEVNKYQYLLTGRIFDGKVYIGLCNF
VERWDQLTISQRKGLNYRYHLGCNCKIKTCYYPPCFVSSKNECVWTDMAASFGYPGHQTK
HYACIRQKGGSCSWYRGWAPPDKTIINATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactccctggctcgggctcgtcgtgctcctgggcacctggagcctggggtactggggc
gccgaggcgtgcacatgctcgcccacccacccccaggaagccttctgcaactctgacata
gtgatccgggccagagtggtggggaagaagctggtgaaggaggggccctatggcacactg
atctacaccatcaagcagatgaagatgtaccggggtttcacaaagatgccccacgtgcag
tacatccacacggaagcttccgagagtctctgtggcgtgaagctggaggtcaacaagtac
cagtacctgctgacaggccggatcttcgatgggaaggtgtacataggactgtgcaacttt
gtggagcggtgggaccagctcaccatctcccagcgcaaggggctgaactatcggtatcac
ctgggttgtaactgcaagatcaagacctgctactacccgccttgcttcgtcagctccaag
aacgagtgtgtctggaccgacatggccgcgagtttcggctaccctggccaccagaccaaa
cactacgcctgcatccggcagaagggtggctcctgcagctggtaccgaggatgggccccc
ccagacaaaaccatcatcaatgccacagacccctga

DBGET integrated database retrieval system