KEGG   Myotis brandtii (Brandt's bat): 102242800Help
Entry
102242800         CDS       T02920                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04110  Cell cycle
myb04213  Longevity regulating pathway - multiple species
myb04330  Notch signaling pathway
myb04919  Thyroid hormone signaling pathway
myb05016  Huntington's disease
myb05034  Alcoholism
myb05165  Human papillomavirus infection
myb05169  Epstein-Barr virus infection
myb05200  Pathways in cancer
myb05202  Transcriptional misregulation in cancer
myb05203  Viral carcinogenesis
myb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:myb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102242800 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102242800 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102242800 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    102242800 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102242800 (HDAC1)
   05202 Transcriptional misregulation in cancers
    102242800 (HDAC1)
   05203 Viral carcinogenesis
    102242800 (HDAC1)
   05220 Chronic myeloid leukemia
    102242800 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    102242800 (HDAC1)
  Substance dependence
   05034 Alcoholism
    102242800 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102242800 (HDAC1)
   05165 Human papillomavirus infection
    102242800 (HDAC1)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102242800 (HDAC1)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102242800 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102242800 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102242800 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102242800 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102242800
NCBI-ProteinID: XP_005878413
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIGMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKLVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTGDEKEKDPEEKKEVTEEEKTKEDKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaaacctcaccgaatcggcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaat
gctgaagagatgaccaagtatcacagcgatgattacataaaattcttgcgctccatccgc
ccagataacatgtctgaatacagcaagcagatgcagagattcaacgttggtgaagactgt
cctgtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaacgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggatctacgggatattggggctggcaaaggcaag
tactatgctgttaactacccgcttcgagatgggattgatgacgagtcctatgaggccatt
tttaaactggtcatatccaaagtgatggagatgtttcaacccagtgcagtcgtcttacag
tgtggctctgactccctgtctggggatcggttaggttgcttcaatctgaccatcaaaggg
cacgccaagtgtgtggaatttgtgaagagctttaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgttgcccgatgctggacatatgaaacagctgtcgccctg
gacacagagattcctaatgagcttccatacaacgactactttgaatactttgggccagat
ttcaaacttcacatcagtccttccaatatgactaaccagaacacaaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccatgcacctggggtccaa
atgcaggcgattcctgaggacgccattccagaggagagtggtgatgaggatgaggaagac
cctgacaagcgcatttcgatctgttcctctgacaaacgaattgcctgtgaggaagagttc
tctgactctgatgaggagggagaaggtggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactggggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggacaagcaagaagccaaaggggttaaagaggaggtcaaa
ttggcctga

DBGET integrated database retrieval system