KEGG   Myotis brandtii (Brandt's bat): 102243445Help
Entry
102243445         CDS       T02920                                 

Gene name
MAP3K9
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
KEGG Orthology (KO) [BR:myb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myb01001]
    102243445 (MAP3K9)
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102243445 (MAP3K9)
Protein kinases [BR:myb01001]
 Serine/threonine kinases: TKL group
  MLK family
   102243445 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr OmpH
Motif
Other DBs
NCBI-GeneID: 102243445
NCBI-ProteinID: XP_014394769
LinkDB All DBs
Position
Un
AA seq 742 aa AA seqDB search
MNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPPFTNILDQLTTIEESGFFEMPKDSFHCL
QDDWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILGR
ELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSL
SSSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVIPKEEGEEEEKRASKKKGRTWGPG
TLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLGKGPRS
SPALPGFTSLTEMEDEDSEGPGSGESRLQHSPNQSYLCIPFPRGEDGDGPPSDTAHEEPT
PVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLPLPEE
PEPPAREEKKKREGLFQRASRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSISE
CNSTRSLLRSDSDEIVVYEMPVTPVEAPPPTPCTHNPLVNIRVERFKRDPNQSLTPTHVT
LTAPTQPSGHRRTPSEGALKPAALLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLP
DPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSASPAN
SSSTETPSNLDSCLASSSSTLEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDSTVP
LCRAELSAHRPAPYEIQQEFWS
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactcgccctccccatcccttctacatgcccagaaccttttgccaaactcatg
gaagattgctggaatcccgacccccattcacgaccacctttcacaaacatcctggaccag
ctaactaccatagaggagtctggtttctttgaaatgcccaaggactccttccactgcctg
caggatgactggaaacatgagattcaggagatgtttgaccaactcagggccaaagaaaag
gagctccgcacctgggaggaggagctgacgcgggcagcgctgcagcagaagaaccaggag
gagctgctgcgacgccgcgagcaggagctggccgagcgggagattgacatcctgggacgc
gagctcaacatcatcatccaccagctgtgccaggagaagccgcgggtgaagaaacgcaag
ggcaagttccgcaagagccggctgaagctcaaggacgggaaccgcatcagcctcccttcg
gatttccagcacaagttcacggtccaggcctcccccaccatggataaaaggaagagcctc
agcagcagccgctccagccctcctgcaagccccaccatcatccctcgccttcgagccatc
cagttgacaccaggtgaaagcagcaaaacctggggccggagctcagtcatcccgaaggag
gaaggagaggaggaggagaagagggcttctaagaagaagggacggacgtgggggccaggg
acactgggtcagaaggagcttgcctcgggcgacgaaggatcccctcagagacgtgagaaa
gctaacgggttaagtaccccatcagaatctccacatttccatttgggcctcaagtccctg
gtagatggatacaaacagtggtcgtccagtgcccccaacctggggaagggccctaggagc
agcccggccctgccagggttcaccagccttacggagatggaggatgaggacagcgaaggc
ccagggagtggggaaagtcgtctacagcattcacccaaccagtcctacctctgtatccca
ttccctcgtggagaggatggggatggcccccccagtgacacagcccacgaggagcccacc
ccagtcaactcagccaccagtacccctcagctgacgccaaccaacagcctcaagcggggc
ggcgcccaccaccgccgctgtgaggtggctctgcttggctgtggggctgttctcgcagcc
acaggcctagggtttgacctgctggaagctggcaagtgccagctgcctctcccagaggag
cctgagccaccagcccgggaggagaagaagaagcgcgagggactttttcagagggccagt
cgtcctcgacggagcaccagccccccatcccggaagctcttcaagaaggaagagcccatg
ctgttgctaggagacccctctgcctccctaacactgctgtctctctcctccatctccgag
tgcaactccacacgctccctgctgcgttcggacagcgatgagatcgtggtgtatgagatg
cctgtcaccccggtggaggccccacccccgaccccttgcacccacaaccccttggtcaac
atccgagtggagcgcttcaaacgggaccctaaccaatctctgactcccacccacgtcacc
ctcacagcccccacacagcccagtggtcaccgtcggaccccttctgagggggccctcaag
ccagcggctctcctggccagcaggagcccctccagcaacgggctgagccccagccctgga
gcaggaatgttgaaaacccccagccccagccgagacccaggtgaattcccccgtctccct
gaccccaatgtagtttttcccccaaccccgaggcgctggaacacacagcaggactctacc
ttggagaggcccaagaccctggagttcctgcctcggccgcgtccttctgccaaccggcaa
cggctggacccctggtggtttgtgtcccccagccacgcccgtagcgcctccccggccaac
agctccagcacagagacacccagcaacctggactcctgccttgctagcagcagcagcact
ttggaggagcggcctgggctcccagccctgctcccgttccaggcggggccgctgcccccc
accgagcggacgctgttggacctggacgcagagggccagagtcaggacagcactgtgcca
ctgtgtagagctgaactgagcgcacacaggcctgccccttacgagatccagcaagagttc
tggtcttag

DBGET integrated database retrieval system